CSF3 (colony stimulating factor 3)

Gene

• Entrez ID: 1440
• Gene name: Colony stimulating factor 3
• Gene symbol: CSF3
• Synonyms (NCBI Gene): C17orf33, CSF3OS, GCSF
• Chromosome: 17
• Chromosome location: 17q21.1
• Summary: This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modifi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT911805	hsa-miR-1254	CLIP-seq
MIRT911806	hsa-miR-1291	CLIP-seq
MIRT911807	hsa-miR-198	CLIP-seq
MIRT911808	hsa-miR-3116	CLIP-seq
MIRT911809	hsa-miR-328	CLIP-seq
MIRT911810	hsa-miR-4269	CLIP-seq
MIRT911811	hsa-miR-4645-5p	CLIP-seq
MIRT911812	hsa-miR-4673	CLIP-seq
MIRT911813	hsa-miR-661	CLIP-seq
MIRT911814	hsa-miR-1197	CLIP-seq
MIRT911815	hsa-miR-1909	CLIP-seq
MIRT911816	hsa-miR-4533	CLIP-seq
MIRT911817	hsa-miR-4747-5p	CLIP-seq
MIRT2447721	hsa-miR-1470	CLIP-seq
MIRT2447722	hsa-miR-188-3p	CLIP-seq
MIRT2447723	hsa-miR-2355-5p	CLIP-seq
MIRT2447724	hsa-miR-4469	CLIP-seq
MIRT2447725	hsa-miR-4667-3p	CLIP-seq
MIRT2447726	hsa-miR-532-3p	CLIP-seq
MIRT2509457	hsa-miR-1207-5p	CLIP-seq
MIRT2509458	hsa-miR-1236	CLIP-seq
MIRT2509459	hsa-miR-1264	CLIP-seq
MIRT2509460	hsa-miR-139-3p	CLIP-seq
MIRT2509461	hsa-miR-1825	CLIP-seq
MIRT2509462	hsa-miR-1912	CLIP-seq
MIRT2509463	hsa-miR-1915	CLIP-seq
MIRT2447723	hsa-miR-2355-5p	CLIP-seq
MIRT2509464	hsa-miR-2467-3p	CLIP-seq
MIRT2509465	hsa-miR-2467-5p	CLIP-seq
MIRT2509466	hsa-miR-3121-3p	CLIP-seq
MIRT2509467	hsa-miR-3144-5p	CLIP-seq
MIRT2509468	hsa-miR-3150a-3p	CLIP-seq
MIRT2509469	hsa-miR-3175	CLIP-seq
MIRT2509470	hsa-miR-3188	CLIP-seq
MIRT2509471	hsa-miR-3191	CLIP-seq
MIRT2509472	hsa-miR-339-5p	CLIP-seq
MIRT2509473	hsa-miR-3653	CLIP-seq
MIRT2509474	hsa-miR-3657	CLIP-seq
MIRT2509475	hsa-miR-3658	CLIP-seq
MIRT2509476	hsa-miR-3664-3p	CLIP-seq
MIRT2509477	hsa-miR-3665	CLIP-seq
MIRT2509478	hsa-miR-3677-3p	CLIP-seq
MIRT2509479	hsa-miR-3678-3p	CLIP-seq
MIRT2509480	hsa-miR-371b-3p	CLIP-seq
MIRT2509481	hsa-miR-3934	CLIP-seq
MIRT2509482	hsa-miR-3975	CLIP-seq
MIRT2509483	hsa-miR-4283	CLIP-seq
MIRT2509484	hsa-miR-4284	CLIP-seq
MIRT2509485	hsa-miR-4421	CLIP-seq
MIRT2509486	hsa-miR-4436a	CLIP-seq
MIRT2509487	hsa-miR-4436b-3p	CLIP-seq
MIRT2509488	hsa-miR-4437	CLIP-seq
MIRT2509489	hsa-miR-4446-3p	CLIP-seq
MIRT2509490	hsa-miR-4447	CLIP-seq
MIRT2509491	hsa-miR-4449	CLIP-seq
MIRT2509492	hsa-miR-4472	CLIP-seq
MIRT2509493	hsa-miR-4488	CLIP-seq
MIRT2509494	hsa-miR-4489	CLIP-seq
MIRT2509495	hsa-miR-4492	CLIP-seq
MIRT2509496	hsa-miR-4498	CLIP-seq
MIRT2509497	hsa-miR-4505	CLIP-seq
MIRT2509498	hsa-miR-4517	CLIP-seq
MIRT2509499	hsa-miR-4641	CLIP-seq
MIRT2509500	hsa-miR-4652-5p	CLIP-seq
MIRT2509501	hsa-miR-4655-3p	CLIP-seq
MIRT2509502	hsa-miR-4667-5p	CLIP-seq
MIRT2509503	hsa-miR-4685-5p	CLIP-seq
MIRT2509504	hsa-miR-4697-5p	CLIP-seq
MIRT2509505	hsa-miR-4700-5p	CLIP-seq
MIRT2509506	hsa-miR-4717-5p	CLIP-seq
MIRT2509507	hsa-miR-4725-5p	CLIP-seq
MIRT2509508	hsa-miR-4726-3p	CLIP-seq
MIRT2509509	hsa-miR-4731-5p	CLIP-seq
MIRT2509510	hsa-miR-4736	CLIP-seq
MIRT2509511	hsa-miR-4740-3p	CLIP-seq
MIRT2509512	hsa-miR-4763-3p	CLIP-seq
MIRT2509513	hsa-miR-4768-3p	CLIP-seq
MIRT2509514	hsa-miR-485-5p	CLIP-seq
MIRT2509515	hsa-miR-486-3p	CLIP-seq
MIRT2509516	hsa-miR-491-5p	CLIP-seq
MIRT2509517	hsa-miR-504	CLIP-seq
MIRT2509518	hsa-miR-511	CLIP-seq
MIRT2509519	hsa-miR-513c	CLIP-seq
MIRT2509520	hsa-miR-514b-5p	CLIP-seq
MIRT911813	hsa-miR-661	CLIP-seq
MIRT2509521	hsa-miR-670	CLIP-seq
MIRT2509522	hsa-miR-762	CLIP-seq
MIRT2509523	hsa-miR-767-3p	CLIP-seq
MIRT2509524	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	23001182
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	NAS	15664994
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	IBA
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	IEA
GO:0005130	Function	Granulocyte colony-stimulating factor receptor binding	TAS	2420009
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	2420009
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2420009
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	15664994
GO:0019899	Function	Enzyme binding	IPI	12393522
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	23001182
GO:0030851	Process	Granulocyte differentiation	NAS	15664994
GO:0038158	Process	Granulocyte colony-stimulating factor signaling pathway	IDA	23001182
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045471	Process	Response to ethanol	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IBA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045639	Process	Positive regulation of myeloid cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23001182
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23001182
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071345	Process	Cellular response to cytokine stimulus	IDA	23001182
GO:0071682	Component	Endocytic vesicle lumen	IEA
GO:0071682	Component	Endocytic vesicle lumen	TAS
GO:0110053	Process	Regulation of actin filament organization	IDA	23001182

Other IDs

• MIM: 138970
• HGNC: 2438
• e!Ensembl: ENSG00000108342

Protein

• UniProt ID: P09919
• Protein name: Granulocyte colony-stimulating factor (G-CSF) (Pluripoietin) (Filgrastim) (Lenograstim)
• Protein function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophag
• PDB: 1CD9, 1GNC, 1PGR, 1RHG, 2D9Q, 5GW9, 5ZO6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16647	GCSF	51 → 202	Granulocyte colony-stimulating factor	Domain

• Sequence:

  MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
  LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
  LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
  AGGVLVASHLQSFLEVSYRVLRHLAQP

• Sequence length: 207

Pathways

KEGG:

Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Hematopoietic cell lineage
IL-17 signaling pathway
Malaria
Coronavirus disease - COVID-19

Reactome:

Other interleukin signaling
Interleukin-10 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, APLASTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
APLASTIC ANEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRALGIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE MARROW NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIARRHEA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSENTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEADACHE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATIC VENO-OCCLUSIVE DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKIN DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA, HEREDITARY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEIOMYOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER FAILURE, ACUTE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, AIDS-RELATED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, B-CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOSITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEUROPATHY, ISCHEMIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCYTOPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, LOCALIZED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMATITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULITIS, LEUKOCYTOCLASTIC, CUTANEOUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Basophilic Leukemia	Basophilic Leukemia	BEFREE	8536230		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	1372766, 20376582, 26010204, 30887181		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10803934, 1689609, 17768113, 26467815, 28556959, 28982056, 29145456, 30034479, 7535143, 7688838, 9529133		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	12816872, 26637693, 29702970, 30127892, 30725360, 30848067, 31115604, 31221952, 31503021		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	7528855		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	7528855		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	2461497, 28454398		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28423506, 28513459		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	10381496, 1690827, 1695704, 18055984, 21262770, 2439153, 2448221, 2459093, 2491776, 25892894, 3501046, 7504151, 7511442, 7535055, 8193361, 8608243		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22714276		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26467815, 30034479, 31256332, 7535143, 7688838		★☆☆☆☆ Found in Text Mining only
Adult Acute Myeloblastic Leukemia	Myeloblastic Leukemia	BEFREE	11732869, 12012328, 7507264		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	CTD_human_DG	17562247		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	27845511		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	26311248		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	28868949		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	CTD_human_DG	15999287		★☆☆☆☆ Found in Text Mining only
Agranulocytosis	Agranulocytosis	BEFREE	24747744, 29107664, 29181135, 3115920, 31824417, 9322685		★☆☆☆☆ Found in Text Mining only
Albinism, Oculocutaneous	Oculocutaneous albinism	BEFREE	11809908		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17894541		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18769539	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31566813		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	18835867, 27544379, 28337172, 30534107, 31100684		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	21659498	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30569457	Inhibit	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30069023		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	28011495, 28185423, 29235141		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	CTD_human_DG	12085204, 16076697, 17047649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	BEFREE	16645228, 20237318, 29089448, 29172978, 30878127, 31207479, 31356228, 9844760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Aplastic	Aplastic anemia	Pubtator	1375845, 16980411, 7689868, 9827895	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	8580564	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	11260077	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia, Macrocytic	Anemia	BEFREE	31448510		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	11122088, 12064910, 20712773, 28447889, 29130518		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	21719598	Associate	★☆☆☆☆ Found in Text Mining only
Angioendotheliomatosis	Angioendotheliomatosis	BEFREE	10449569		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28578701, 28775207, 30147373		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Rupture	Aortic Rupture	BEFREE	25563839		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	CTD_human_DG	10544668, 10629575, 15863969, 1642096, 16553037, 9777751		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aplastic Anemia	Aplastic anemia	BEFREE	11122117, 12393278, 14607763, 28254831, 7522519, 7524889, 9236159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Appendicitis	Appendicitis	BEFREE	9433376		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	33776989	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29138752		★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	37280058	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	BEFREE	16710471, 28320832		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22860122, 37280058	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	30327490	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	1372187, 28239238, 9691097	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12594295, 24813055, 27163155, 29378629		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	12594295, 29378629, 31744834, 34510493, 38507932	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	1377084, 8699223		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	1377084	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29138752		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36835545	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	12676791		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	12676791	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	CTD_human_DG	11042651		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	14743197, 28870643		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	8639905		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	7525676		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10089916, 24001178	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	30071526, 31207293		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	30071526		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	14751388, 9231915		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	14751388, 17572226		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	17515069, 7525883		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	10648422		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	8608239	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	12676791	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow failure syndromes	Bone marrow failure syndrome	BEFREE	12676791		★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone Marrow Neoplasms	CTD_human_DG	20026017		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Resorption	Bone resorption	Pubtator	37365568	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	17127321		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31005633		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	12926135, 16076697, 16298037, 17047649, 7541186, 7543699, 7692001, 9018096		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15516962, 15767638, 21524920, 24068539, 27491287, 27709313, 28456908, 28637287, 28834401, 28848182, 28929372, 29091995, 29152672, 29214415, 29227817, 29317553, 29392707, 29948957, 30043207, 30058363, 30172372, 30181755, 30348199, 30778902, 30959218, 31405784, 31440986, 31489570, 31502114, 31728715		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10192440, 10473803, 15386335, 17261184, 24026883, 30778902, 30814616, 32242230	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	31799226		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	28687420		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29401143, 7539624		★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	29871518		★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31522450	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	37926435	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	9018096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37904170, 8639772	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	14751388, 7514696, 7681120, 9231915		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11011119, 11062337, 12079515, 1701653, 17342342, 28483607, 29237905, 29594877, 30058363, 31122176, 31433700, 31479879, 9468557		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	24220695	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31366794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	1689190	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10673310	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11283939, 15214947, 31467066, 7529065		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	23398819, 30013550, 31054117		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27025690	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	17334414		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	17334414		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28602846		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	29327204		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	18832793, 30186473, 30536714, 31005633, 31564240		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24387791, 25849550	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31481525	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28109298, 29780293		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	28176642, 28374506, 31660819		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	17047971		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17474298, 18832793, 20026112, 20557950, 25849550, 27524669, 28029607, 28406964, 29277709, 29857523, 30981793, 31564240		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	25849550	Associate	★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	7504508		★☆☆☆☆ Found in Text Mining only
Chagas Cardiomyopathy	Chagas Cardiomyopathy	BEFREE	23964077		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20026017, 26467815, 30034479, 7535143, 7688838		★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	12012328, 30848067		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26311248		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8955505		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	16689657		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	24489443, 26743340	Associate	★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28558308, 31473638, 8704221		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31582549		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12835916, 8639905, 8990100		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	20174635, 24240679, 25545153		★☆☆☆☆ Found in Text Mining only
Chronic neutropenia	Neutropenia	BEFREE	9368331		★☆☆☆☆ Found in Text Mining only
Chronic Neutrophilic Leukemia	Neutrophilic Leukemia	BEFREE	12393423, 23604229, 23656643		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	12594295, 18353856, 31269827		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26211001, 30922293	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	18785976, 20005281		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	23058034		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	20026112, 25877663		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	11383585, 12901851, 16689657, 24322501, 28973941, 29172978		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	18160345	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21129005, 36860851	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24448357, 25976379, 31838134		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	24448357		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	25400792	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28881590		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15879049, 25400792, 25875151, 33606788	Associate	★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	29701561, 30497202, 30774583		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11978940, 15287942, 16980411, 31582549, 7531261		★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	10372134, 10449521, 10590052, 10779444, 10887102, 11071667, 11146160, 11957189, 12387964, 12477275, 15069015, 15198743, 15353486, 15642668, 15813856, 16229088, 16584360, 16670064, 16822461, 16980411, 16985178, 1705835, 17311988, 18513286, 18703682, 18923646, 19796237, 20237318, 21595885, 21618407, 23351988, 23382209, 23758768, 24394665, 26193632, 26637693, 27913459, 28390595, 28453180, 29092827, 30615612, 7577650, 8536230, 9116280, 9576194, 9691084, 9885205, 9989983		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	12645855, 19151252		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	15585077		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	29091995, 29317553		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29050255		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20078384, 30316200		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	20078384, 30316200		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20078384, 30316200		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	16907898, 34857759	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	18160345	Stimulate	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	10887102, 11957190, 24394665, 29517659, 7519075		★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	10887102	Inhibit	★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	11133754, 1371412, 1375103, 1692489	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18026571	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	26022954, 26485688, 31870630	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28752679, 29922175		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	27630018		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29016822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	9018096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	34211033	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	26458100		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	9885446		★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	23058034	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28399484, 28850875, 31430066		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18832793, 28399484, 28850875, 31430066		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28739185	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30012675		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25969153		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31237127		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	26190836		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	29171913		★☆☆☆☆ Found in Text Mining only
Diffuse Mixed-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11343785, 8536230		★☆☆☆☆ Found in Text Mining only
Drug-Induced Stevens Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	11321886		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	18310499		★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	18310499	Associate	★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	9163594	Inhibit	★☆☆☆☆ Found in Text Mining only
Ectrodactyly	Ectrodactyly	Pubtator	25821806	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	29127060		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29752277, 31741758		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28433374, 29456564		★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	20386986		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	10086726		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31467066		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29237905		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	7692001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10673310	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	17694551, 31042138		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	11698271, 8781414	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	28801449, 29510476, 7691632		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	28801449, 29510476, 7691632		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25671834		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27935258		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	22320923, 31147180		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	28009062		★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	CTD_human_DG	17047649		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29554539		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	CTD_human_DG	17047649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	27571123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor	Tumor	BEFREE	27165295, 28943331		★☆☆☆☆ Found in Text Mining only
Gerstmann-Straussler-Scheinker Disease	Gerstmann-Straussler-Scheinker syndrome	BEFREE	29652549		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	9844760		★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	26748993	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	10550313, 26180083, 31282108	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	1701653, 22313638, 28459367, 31282108		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21636707	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22313638, 28459367, 31282108		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10550313, 21636707, 22313638, 34643804	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	1377084, 22313638		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	30286731, 30443809		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis, Membranoproliferative	Glomerulonephritis	BEFREE	30286731		★☆☆☆☆ Found in Text Mining only
Glucose-6-phosphate transport defect	Glucose-6-Phosphate Transport Defect	BEFREE	27864142, 30451720		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen storage disease	Pubtator	15888252, 30451720	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	BEFREE	29652549		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type I	Glycogen Storage Disease	BEFREE	20386986		★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11698124, 11835352, 12676791, 22171570, 29801459	Inhibit	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26743340, 33777007	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	12393418, 12476277, 15699110, 17339194, 22171570, 22658922, 24244025, 26010204, 28169418, 28189902, 28676100, 28691152, 29100905, 29101827, 30036571, 30503387, 30833742, 30885244, 31182560, 31401973, 31427277		★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	23031229	Stimulate	★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Granulomatous disease	Pubtator	25143186, 8704221	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	31152919		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11391619		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	7692001		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	19429242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	15585077		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	19151252		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	15585077		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	9774950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	10516681, 10829047, 12476277, 19182834, 19382033, 21929286, 23201472, 29307717, 30277108, 30565075, 30827127, 30961974, 31440986, 31663634		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	33108454	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	27938485, 30254339, 7519508		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	1701653		★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	20712773, 31424633		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	9616145	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9827910	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Veno-Occlusive Disease	Hepatic veno-occlusive disease-immunodeficiency syndrome	CTD_human_DG	8602625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatitis B	Hepatitis b	Pubtator	7545429	Associate	★☆☆☆☆ Found in Text Mining only
Hepatorenal Syndrome	Hepatorenal Syndrome	BEFREE	28840583		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10482930, 27845511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin disease	Pubtator	1632458, 24141626, 7545429	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	CTD_human_DG	17562247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin lymphoma, lymphocyte depletion	Hodgkin Lymphoma, Lymphocyte Depletion	CTD_human_DG	17562247		★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	CTD_human_DG	8602625		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercalcemia	Hypercalcemia	Pubtator	7549149	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23933910		★☆☆☆☆ Found in Text Mining only
Hypoplastic anemia	Hypoplastic anemia	CTD_human_DG	10544668, 10629575, 15863969, 1642096, 16553037, 9777751		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10880747	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25849550	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23933910		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	19117745		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	30778902	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28527810, 30045290, 7540891		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28374506		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	1370662, 29652549, 31567972		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	26458100		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	18956268, 29651017		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	25849550, 29277709, 31564240, 31768951		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	30327490		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	19429242		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	30056257, 30792422		★☆☆☆☆ Found in Text Mining only
Large cell carcinoma of lung	Lung Carcinoma	BEFREE	12377411		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	24149774		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	25754690		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	15585077		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	CTD_human_DG	9774950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyosarcoma, Epithelioid	Leiomyosarcoma	CTD_human_DG	9774950		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma, Myxoid	Leiomyosarcoma	CTD_human_DG	9774950		★☆☆☆☆ Found in Text Mining only
Lesion of Sciatic Nerve	Lesion Of Sciatic Nerve	BEFREE	30981793		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10536003, 11071667, 15102480, 1688504, 1692082, 1699919, 2459093, 2473799, 30208330, 7994039, 8608239, 8639905, 8839834	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10803934, 10975389, 11071667, 12070011, 12162814, 12476277, 15203865, 15223604, 15642668, 16791271, 16985178, 17127321, 18204965, 18536571, 20165869, 21595885, 2448221, 26542893, 26637693, 28454398, 28574591, 7505148		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11157490, 35768562	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1373742, 1688503, 1689190, 1702329	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	2439153	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10225671	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10340405, 10354136, 10887102, 10940650, 11122104, 11122117, 11290617, 15102480, 16413391, 1688720, 1698193, 1699919, 1705566, 18923646, 2018839, 2070083, 21233314, 22015065, 22371884, 2479427, 28097942, 30208330, 3257144, 3264194, 3304459, 33948920, 3495305, 7542747, 8608239, 8805932, 8839834	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11071667, 12489493	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	1378916	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10381496	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10622210, 15755292, 21262770, 21283726, 2439153, 2459093, 2491776, 7511442, 8608243, 9590146	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	9092691		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10354136, 10372134, 10460615, 10676644, 10887102, 10940650, 11071667, 11168757, 11187903, 11732869, 12012328, 12019034, 12203110, 12393278, 12816872, 15069015, 15124669, 15203865, 15223604, 1533785, 15370243, 16121216, 16790275, 16791271, 16822461, 16828156, 1689609, 1690827, 1701231, 17054431, 1705566, 17874449, 18756545, 18923646, 1961022, 20237318, 20406937, 21130493, 21911095, 2197515, 22015065, 23953336, 23978944, 24394665, 2455572, 24724783, 24990142, 25545153, 26415557, 26637693, 27005833, 27544285, 27860411, 28097942, 28189902, 28231491, 28454398, 28508228, 28584934, 28864170, 29030092, 29043875, 29162833, 29288428, 29292108, 29516766, 29616840, 29652549, 29702970, 29720734, 30108326, 30127892, 30208330, 30253387, 30300822, 30478089, 30548485, 30565075, 30725360, 30848067, 31112940, 31221952, 31248972, 31303761, 31503021, 3257144, 3495305, 7505148, 7515302, 7542747, 7687196, 8487587, 8907269, 9001413, 9116280, 9691084, 9722293, 9885205, 9886253, 9989983		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	7528855		★☆☆☆☆ Found in Text Mining only
Leukemoid Reaction	Leukemoid Reaction	BEFREE	7514696		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	9473215	Associate	★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	10607719, 10877051, 11005621, 11062337, 11383585, 11475155, 11809908, 12120235, 12232843, 12804646, 14607763, 14979480, 15203865, 15214947, 15906092, 16912178, 17006547, 17127321, 17311988, 17584878, 17593093, 17602053, 19319942, 20616219, 21668998, 21844566, 22427476, 23196894, 23674093, 25469044, 26798659, 27509033, 27568305, 27571123, 27649291, 27709313, 27751704, 27813720, 27841775, 27845511, 27864142, 28107322, 28179275, 28216660, 28231491, 28314052, 28419427, 28437295, 28515226, 28619479, 28637287, 28744022, 28747065, 28789371, 28817489, 28848182, 28870106, 28939926, 28967792, 28973394, 28990128, 29027153, 29061534, 29072395, 29091995, 29103159, 29172983, 29223991, 29237905, 29253744, 29283548, 29285951, 29296907, 29318653, 29392707, 29398477, 29401143, 29403286, 29492357, 29562228, 29574886, 29632660, 29652549, 29859255, 29936477, 29968171, 30034479, 30036571, 30040168, 30043207, 30112626, 30122896, 30128950, 30147373, 30168270, 30174163, 30181755, 30249869, 30280277, 30328531, 30374765, 30410313, 30451719, 30451720, 30497339, 30514339, 30581162, 30615612, 30625055, 30633375, 30642286, 30727980, 30856657, 30875590, 30887581, 30900095, 30959218, 30997742, 30998754, 31003920, 31042138, 31090035, 31122176, 31142911, 31152605, 31152919, 3115920, 31272062, 31294492, 31356228, 31405784, 31408256, 31440986, 31452317, 31489570, 31583943, 31623097, 31728715, 31798380, 31818168, 31842164, 8669967, 8989458, 9486673, 9760159, 9773234, 9885446		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	CTD_human_DG	16076697, 16120623, 16937080, 7543699		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	24149774		★☆☆☆☆ Found in Text Mining only
Linear Scleroderma	Linear Scleroderma	CTD_human_DG	15863969		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31607857		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	21790860		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	1701653		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18574771, 29127060		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	36159788	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	21175804	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	36159788	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	CTD_human_DG	21550386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Failure, Acute	Liver failure	BEFREE	31400854		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	29725401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	9018096		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Localized scleroderma	Scleroderma	CTD_human_DG	15863969		★☆☆☆☆ Found in Text Mining only
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	15972674, 38507932	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	12708493, 31366794, 34498383, 36100844	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16211258		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30563424		★☆☆☆☆ Found in Text Mining only
Lymphocyte Rich Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	17562247		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	10803934, 8724545		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11567990, 12542495, 18608348, 27578390, 28476490, 28554533, 28631842, 29283559, 29398647, 29446445		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	33108454, 9074411	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lymphoma, Intermediate-Grade	Intermediate Grade Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell	Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	10482930, 14979480, 27491287, 27905003, 27928760, 28456908, 28797783, 28879595, 29171913, 29238988, 29295612, 29410180, 29895931, 30548485, 31363366, 31433700, 8747988, 8959247, 9326252		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	14979480, 27491287, 27905003, 29171913, 29238988, 29410180, 29895931, 31433700, 8959247		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Macrophage Activation Syndrome	Macrophage Activation Syndrome	BEFREE	31473638		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31827384		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11391619		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	2787682, 31479879		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	12926135, 16076697, 16298037, 17047649, 7541186, 7543699, 7692001, 9018096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15516962, 15767638, 21524920, 24068539, 27491287, 27709313, 28456908, 28637287, 28834401, 28848182, 28929372, 29091995, 29152672, 29214415, 29227817, 29317553, 29392707, 29948957, 30043207, 30058363, 30172372, 30181755, 30348199, 30778902, 30959218, 31405784, 31440986, 31489570, 31502114, 31728715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29752277, 31741758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29554539		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29725401		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11062337, 12079515, 1701653, 17342342, 28483607, 29237905, 29594877, 30058363, 31122176, 31433700, 9468557		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31607857		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11283939, 15214947, 7529065		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	9855271		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22252524		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	9774950		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29567938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	14751388, 9231915		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	17515069, 7525883		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11519978, 15214947, 15642668, 16912178, 17054431, 19182834, 19678823, 20136781, 22988839, 25599171, 26278331, 27497531, 27509033, 28254519, 28397022, 28438855, 28494406, 28619479, 28622961, 28646705, 28692671, 28817190, 28834401, 28870106, 29508899, 29562228, 29687743, 29752277, 30017795, 30058363, 30069023, 30084301, 30200842, 30529460, 30778902, 30835142, 30875590, 30959218, 30961974, 31003920, 31127438, 31294492, 31440986, 31607857, 31653961		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24448357, 25976379, 31838134		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	12926135, 16076697, 16298037, 17047649, 7541186, 7543699, 7692001, 9018096		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	12926135, 16076697, 16298037, 17047649, 7541186, 7543699, 7692001, 9018096		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26071407, 30348199		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	12926135, 16076697, 16298037, 17047649, 7541186, 7543699, 7692001, 9018096		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	26311248		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26311248	Associate	★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	16120623, 16260693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	26124323, 3498641, 9060833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere Disease	Meniere disease	Pubtator	36175465	Stimulate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23539121		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29016822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	25757056, 2787682	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28082237		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	27977881		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	31559495, 9722293, 9803678		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	29709100, 30776296, 30832584, 31389280, 31680063		★☆☆☆☆ Found in Text Mining only
Mixed Cellularity Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	17562247		★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	CTD_human_DG	15863969		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	10233729, 30475299		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10233729	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	12019034		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10648422, 12374689, 25278456, 26389776, 27001243, 27578390, 27735212, 27905003, 28013359, 28439700, 28653421, 28675459, 28797783, 29058701, 29388164, 29390394, 29398647, 29410180, 30142418, 30149148, 30266677, 30459429, 30642286, 30924165, 30961974, 31358485, 31363366, 31495201, 31534192, 7510989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	33108454	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	7534716, 7540856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25697397, 28396953, 28646409, 30327490, 30939124, 31139690		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30327490	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	31001554	Inhibit	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29123500, 31001554		★☆☆☆☆ Found in Text Mining only
Mycoplasma-Induced Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	11321886		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	24170028, 29172978, 31248972		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10676644, 10887102, 11699198, 11978940, 12012328, 12064461, 12393278, 15287942, 15370243, 15644419, 1690318, 1698477, 1710505, 18490591, 18829110, 20237318, 23953336, 24170028, 25545153, 26010204, 26637693, 27860411, 29172978, 29652549, 29675620, 29720275, 29776423, 30127892, 30253387, 30548485, 30878127, 31248972, 31559495, 7512175, 7516887, 7522519, 7531261, 8536230, 8611449, 9001413, 9722293, 9803678		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	12393561, 18297540		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11122117, 1698477, 8704190	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12489493, 12542495, 26637693, 9827895	Stimulate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	8943864	Inhibit	★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	28453180, 7690442		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	1689609, 2448221		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10536003, 10870123, 10975389, 12750692, 14562121, 1692082, 1702329, 1961020, 20376582, 20952060, 23656643, 7510105, 7511442, 7682859, 7687196, 8769707, 9593273, 9886253		★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	10607719, 11005621, 9329467		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	2455572		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	25545153, 26458100, 30009791		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE DISORDER, CHRONIC, WITH EOSINOPHILIA	Myeloproliferative Disorder with Eosinophilia	BEFREE	12645855		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	15585077		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	16051386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	18832728, 18956268, 19151252, 19929464, 25754690, 27790799, 29651017, 30942413, 31037857, 31495390		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30262215, 30316200		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	23964077		★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29123500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopathy	Myopathy	CTD_human_DG	7543699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myositis	Myositis	Pubtator	39946176	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	26211001	Inhibit	★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	24994458		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	36211987	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10374783, 11011119, 11283939, 12708493, 15027115, 15214947, 15516962, 16912178, 1701653, 1704443, 1710208, 17342342, 17694551, 19678823, 22952847, 22988839, 23674093, 24448357, 25976379, 27183469, 28646705, 28775207, 28789371, 29283559, 29567938, 29707043, 29707135, 29720734, 29752277, 29805099, 30017795, 30149148, 30322928, 30348199, 31479879, 31522450, 31552036, 31694706, 31741758, 7508889, 7514696, 7591233, 7681120, 7687898, 7690442, 7691144, 8186297, 8699223, 9610689		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	9531608		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	24387791	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	CTD_human_DG	17047649		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
nervous system disorder	Nervous System Disorder	BEFREE	29277709		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural crest tumor	Neural Crest Tumor	BEFREE	27428599		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	8580564	Stimulate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12942094, 23687340, 31803140		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18485949	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	2491776		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	10607719, 10877051, 11005621, 11062337, 11383585, 11809908, 12120235, 12232843, 12687405, 12750178, 12804646, 14607763, 14979480, 15203865, 15906092, 16912178, 17006547, 17127321, 17311988, 17584878, 17602053, 19319942, 20237318, 20616219, 21668998, 21844566, 22427476, 23196894, 23674093, 25469044, 26798659, 27509033, 27568305, 27571123, 27649291, 27709313, 27751704, 27813720, 27841775, 27845511, 27864142, 28107322, 28216660, 28231491, 28419427, 28437295, 28515226, 28619479, 28637287, 28744022, 28747065, 28789371, 28817489, 28848182, 28870106, 28939926, 28967792, 28973394, 28990128, 29027153, 29061534, 29072395, 29091995, 29172983, 29222242, 29223991, 29237905, 29253744, 29283548, 29285951, 29296907, 29318653, 29392707, 29398477, 29401143, 29403286, 29492357, 29562228, 29574886, 29632660, 29652549, 29859255, 29936477, 29968171, 30034479, 30036571, 30040168, 30043207, 30112626, 30122896, 30128950, 30147373, 30168270, 30174163, 30181755, 30249869, 30280277, 30328531, 30374765, 30410313, 30451719, 30451720, 30497339, 30514339, 30581162, 30615612, 30625055, 30633375, 30642286, 30727980, 30856657, 30875590, 30900095, 30959218, 30997742, 30998754, 31003920, 31042138, 31090035, 31122176, 31142911, 31152605, 31152919, 3115920, 31272062, 31294492, 31356228, 31405784, 31408256, 31440986, 31452317, 31489570, 31583943, 31623097, 31728715, 31798380, 31818168, 31842164, 8669967, 8989458, 9486673, 9760159, 9773234, 9885446		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	10607719, 1692489, 18485949, 19881296, 24397109, 30451720, 33483893, 33560392, 38478670, 7535595, 8652846, 9074411	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	11091218, 12884304, 1373092, 1721056, 22027004, 24594699, 39252295, 7510142	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	CTD_human_DG	11712802, 12085204, 12884814, 12926135, 15585077, 16761898, 27737899, 7524159, 7529132, 7543699, 7688884, 9740541, 9774950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	LHGDN	12636092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	10590052, 1371412, 15813856, 16980411, 18923646, 22371884, 26193632, 26637693, 31248972, 7510142, 7514305, 7693032, 8541539	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	10887102, 11071667, 22624626	Inhibit	★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	10764151, 10843738, 11714825, 20971950, 24813055, 26293782, 26389776, 28515226, 28724384, 29078378, 30286731, 31509227, 31552036, 9989983		★☆☆☆☆ Found in Text Mining only
Neutrophilia, Hereditary	Neutrophilia	BEFREE	23604229		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	CTD_human_DG	17562247		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29228666		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12708493, 29594877, 29963237, 30206044, 30859745, 30968997, 31080780		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16046292		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20057362	Associate	★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	CTD_human_DG	12085204		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	28791814		★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	BEFREE	31154348, 9486673		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28205383, 31590365		★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	31175224		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	20174635, 31063988, 31175224		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	8606492		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	7508889, 8608800		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11283939, 15214947		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	31034039		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	7529065		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24220695, 32878513	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39609146	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	9855271		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30147373		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28185423		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28578701		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	CTD_human_DG	17505274, 9051142		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancytopenia	Pancytopenia	BEFREE	29626003, 29656748, 31154348, 31793821, 9092691		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraneoplastic Syndromes	Paraneoplastic Syndromes	BEFREE	11011119		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27938485, 29327204		★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	11530804, 30253387		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24476546, 31765840		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	27531006, 37365568	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29877199		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31152605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	9740541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31152605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Platelet Storage Pool Deficiency	Platelet Storage Pool Deficiency	BEFREE	11809908		★☆☆☆☆ Found in Text Mining only
Polyarthralgia	Polyarthralgia	CTD_human_DG	7543699		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	28082237		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17764815, 19497108, 20194236, 31675371		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29949798		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	1689609, 17768113, 28982056, 7535143, 9529133		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	27630018		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	31566813		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	36167867	Associate	★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	23196894		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	17764815, 28453180, 7690442		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22252524		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22252524	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasiform eczema	Psoriasiform eczema	BEFREE	15186319		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15186319, 28239238, 29676778		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28239238	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	12594295	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17894541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30719047		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	31479879		★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	BEFREE	9885446		★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	BEFREE	28657605, 28850300, 29787425		★☆☆☆☆ Found in Text Mining only
Refractory anaemia with excess blasts	Myelodysplastic syndrome	BEFREE	1698477		★☆☆☆☆ Found in Text Mining only
Refractory anemia with ringed sideroblasts	Anemia With Ringed Sideroblasts	BEFREE	20408843		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	20408843, 8611449		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	30286731		★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	24994458		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	28103598	Stimulate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	39739128	Associate	★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	CTD_human_DG	11911406		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34544594	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	21059898		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28239238, 28967792		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	23933910		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	1701653		★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	23058034	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17694551	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	CTD_human_DG	15863969		★☆☆☆☆ Found in Text Mining only
secondary acute myeloid leukemia	Myeloid leukemia	BEFREE	11860441		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34566996	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10815788, 15203865, 16081684, 17311988, 22475305, 24747744, 25284454, 26293782, 26798659, 27649291, 28769538, 29127060, 31628962, 31732687		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	17505274		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	20237318, 20380540, 29100905, 31582549, 31749802, 7689868, 9803678		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	25143186, 8704221	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	27436627, 8704221		★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	12120235, 17379068		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	10597195		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	11583982	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	9774950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28390595		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	CTD_human_DG	9093707		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	1689190, 31366794, 32020764	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	23324130		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	27568305		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	CTD_human_DG	7543699		★☆☆☆☆ Found in Text Mining only
Somatosensory Disorders	Somatosensory Disorders	CTD_human_DG	7543699		★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	21554323		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16912178		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	1704443, 31607857		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19385965, 37470590	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31479879		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	16912178, 23634280		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31138020		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25671834		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome	Stevens-Johnson Syndrome	CTD_human_DG	11321886		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	CTD_human_DG	11321886		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29567938		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10673310, 24448357, 29567938	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	CTD_human_DG	12085204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	28791814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis Aphthous	Aphthous stomatitis	Pubtator	21478439	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	24397109	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	11168757		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	38478670	Stimulate	★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	9092691		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	8580564	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombocytosis	Thrombocytosis	BEFREE	31741758		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	7549149	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	CTD_human_DG	11321886		★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	CTD_human_DG	20026017		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32242230	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	28011495, 28185423, 29235141		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	9018096		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	7692001		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10710253, 1704940, 3499191, 7515769, 9166942	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic neoplasm	Pubtator	39739128	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	CTD_human_DG	9774950		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28827632	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	CTD_human_DG	9774950		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	Pubtator	35061677	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	18473772		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	31391329		★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	31391329		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	25082408	Associate	★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	12750178		★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038	Stimulate	★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	21921047	Stimulate	★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	10607719	Inhibit	★☆☆☆☆ Found in Text Mining only