TTC36 (tetratricopeptide repeat domain 36)

Gene

• Entrez ID: 143941
• Gene name: Tetratricopeptide repeat domain 36
• Gene symbol: TTC36
• Synonyms (NCBI Gene): HBP21
• Chromosome: 11
• Chromosome location: 11q23.3
• Summary: The protein encoded by this gene has three tetratricopeptide repeats and is a chaperone for heat shock protein 70. The encoded protein may function as a tumor suppressor in hepatocellular carcinoma (HCC) since it promotes apoptosis but is downregulated in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT042389	hsa-miR-484	CLASH	23622248

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0006570	Process	Tyrosine metabolic process	IBA
GO:0006570	Process	Tyrosine metabolic process	IEA
GO:0007613	Process	Memory	IEA
GO:0008542	Process	Visual learning	IEA
GO:0021954	Process	Central nervous system neuron development	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:1902915	Process	Negative regulation of protein polyubiquitination	IEA

Other IDs

• MIM: 620701
• HGNC: 33708
• e!Ensembl: ENSG00000172425

Protein

• UniProt ID: A6NLP5
• Protein name: Tetratricopeptide repeat protein 36 (TPR repeat protein 36) (HSP70-binding protein 21)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13424	TPR_12	83 → 153		Repeat

• Sequence:

  MGTPNDQAVLQAIFNPDTPFGDIVGLDLGEEAEKEEREEDEVFPQAQLEQSKALELQGVM
  AAEAGDLSTALERFGQAICLLPERASAYNNRAQARRLQGDVAGALEDLERAVELSGGRGR
  AARQSFVQRGLLARLQGRDDDARRDFERAARLGSPFARRQLVLLNPYAALCNRMLADMMG
  QLRRPRDSR

• Sequence length: 189

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	18587674		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35846428	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37120619	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertyrosinemia	Hypertyrosinemia	BEFREE	31537781		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26246424		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18587674		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26246424		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31537781		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	18587674		★☆☆☆☆ Found in Text Mining only
Tyrosinemias	Tyrosinemia	BEFREE	31537781		★☆☆☆☆ Found in Text Mining only