Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	143903
Gene name	Layilin
Gene symbol	LAYN
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q23.1

Show/Hide all (56)

miRTarBase ID	miRNA	Experiments	Reference
MIRT512422	hsa-miR-483-5p	HITS-CLIP	21572407
MIRT512421	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT706605	hsa-miR-6849-3p	HITS-CLIP	21572407
MIRT512420	hsa-miR-6832-5p	HITS-CLIP	21572407
MIRT512419	hsa-miR-4732-5p	HITS-CLIP	21572407
MIRT512418	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT512417	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT512416	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT706604	hsa-miR-3674	HITS-CLIP	21572407
MIRT512415	hsa-miR-1303	HITS-CLIP	21572407
MIRT512422	hsa-miR-483-5p	HITS-CLIP	21572407
MIRT512421	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT706605	hsa-miR-6849-3p	HITS-CLIP	21572407
MIRT512420	hsa-miR-6832-5p	HITS-CLIP	21572407
MIRT512419	hsa-miR-4732-5p	HITS-CLIP	21572407
MIRT512418	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT512417	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT512416	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT706604	hsa-miR-3674	HITS-CLIP	21572407
MIRT512415	hsa-miR-1303	HITS-CLIP	21572407
MIRT512422	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT512421	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT512420	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT512419	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT512418	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT512417	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT512416	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT512415	hsa-miR-1303	PAR-CLIP	23446348
MIRT512422	hsa-miR-483-5p	HITS-CLIP	21572407
MIRT512421	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT706605	hsa-miR-6849-3p	HITS-CLIP	21572407
MIRT512420	hsa-miR-6832-5p	HITS-CLIP	21572407
MIRT512419	hsa-miR-4732-5p	HITS-CLIP	21572407
MIRT512418	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT512417	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT512416	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT706604	hsa-miR-3674	HITS-CLIP	21572407
MIRT512415	hsa-miR-1303	HITS-CLIP	21572407
MIRT512422	hsa-miR-483-5p	HITS-CLIP	21572407
MIRT512421	hsa-miR-4781-3p	HITS-CLIP	21572407
MIRT706605	hsa-miR-6849-3p	HITS-CLIP	21572407
MIRT512420	hsa-miR-6832-5p	HITS-CLIP	21572407
MIRT512419	hsa-miR-4732-5p	HITS-CLIP	21572407
MIRT512418	hsa-miR-6501-5p	HITS-CLIP	21572407
MIRT512417	hsa-miR-4423-5p	HITS-CLIP	21572407
MIRT512416	hsa-miR-744-3p	HITS-CLIP	21572407
MIRT706604	hsa-miR-3674	HITS-CLIP	21572407
MIRT512415	hsa-miR-1303	HITS-CLIP	21572407
MIRT512422	hsa-miR-483-5p	PAR-CLIP	23446348
MIRT512421	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT512420	hsa-miR-6832-5p	PAR-CLIP	23446348
MIRT512419	hsa-miR-4732-5p	PAR-CLIP	23446348
MIRT512418	hsa-miR-6501-5p	PAR-CLIP	23446348
MIRT512417	hsa-miR-4423-5p	PAR-CLIP	23446348
MIRT512416	hsa-miR-744-3p	PAR-CLIP	23446348
MIRT512415	hsa-miR-1303	PAR-CLIP	23446348

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001726	Component	Ruffle	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005540	Function	Hyaluronic acid binding	IBA
GO:0005540	Function	Hyaluronic acid binding	IDA	11294894
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	ISS
GO:0009986	Component	Cell surface	ISS
GO:0016020	Component	Membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA

MIM	HGNC	e!Ensembl
618843	29471	ENSG00000204381

Q6UX15

Protein name

Layilin

Protein function

Receptor for hyaluronate.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	60 → 186	Lectin C-type domain	Domain

Sequence

MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLRGGQPVCRGGTQRPCYKVIYFHDTSR
RLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLLPSDGDFWIGLRRREEKQSNSTA
CQDLYAWTDGSISQFRNWYVDEPSCGSEVCVVMYHQPSAPAGIGGPYMFQWNDDRCNMKN
NFICKYSDEKPAVPSREAEGEETELTTPVLPEETQEEDAKKTFKESREAALNLAYILIPS
IPLLLLLVVTTVVCWVWICRKRKREQPDPSTKKQHTIWPSPHQGNSPDLEVYNVIRKQSE
ADLAETRPDLKNISFRVCSGEATPDDMSCDYDNMAVNPSESGFVTLVSVESGFVTNDIYE
FSPDQMGRSKESGWVENEIYGY

Sequence length

382

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24398667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37996402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36398067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17822380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28978412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26410531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29429372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	26410531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28978412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	17822380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	31145904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17822380, 30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30761122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30761122	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LAYN (layilin)