Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1439
Gene name	Colony stimulating factor 2 receptor subunit beta
Gene symbol	CSF2RB
Synonyms (NCBI Gene)	CD131CDw131IL3RBIL5RBSMDP5betaGMR
Chromosome	22
Chromosome location	22q12.3
Summary	The protein encoded by this gene is the common beta chain of the high affinity receptor for IL-3, IL-5 and CSF. Defects in this gene have been reported to be associated with protein alveolar proteinosis (PAP). [provided by RefSeq, Jul 2008]

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs672601313	C>A,T	Pathogenic	Coding sequence variant, missense variant, stop gained

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756278	hsa-miR-877-3p	qRT-PCRELISA	34768991
MIRT911750	hsa-miR-1297	CLIP-seq
MIRT911751	hsa-miR-132	CLIP-seq
MIRT911752	hsa-miR-137	CLIP-seq
MIRT911753	hsa-miR-150	CLIP-seq
MIRT911754	hsa-miR-155	CLIP-seq
MIRT911755	hsa-miR-181a	CLIP-seq
MIRT911756	hsa-miR-181b	CLIP-seq
MIRT911757	hsa-miR-181c	CLIP-seq
MIRT911758	hsa-miR-181d	CLIP-seq
MIRT911759	hsa-miR-188-3p	CLIP-seq
MIRT911760	hsa-miR-204	CLIP-seq
MIRT911761	hsa-miR-210	CLIP-seq
MIRT911762	hsa-miR-211	CLIP-seq
MIRT911763	hsa-miR-212	CLIP-seq
MIRT911764	hsa-miR-214	CLIP-seq
MIRT911765	hsa-miR-25	CLIP-seq
MIRT911766	hsa-miR-26a	CLIP-seq
MIRT911767	hsa-miR-26b	CLIP-seq
MIRT911768	hsa-miR-3145-3p	CLIP-seq
MIRT911769	hsa-miR-3199	CLIP-seq
MIRT911770	hsa-miR-32	CLIP-seq
MIRT911771	hsa-miR-3201	CLIP-seq
MIRT911772	hsa-miR-342-3p	CLIP-seq
MIRT911773	hsa-miR-3607-5p	CLIP-seq
MIRT911774	hsa-miR-3613-3p	CLIP-seq
MIRT911775	hsa-miR-3619-3p	CLIP-seq
MIRT911776	hsa-miR-3619-5p	CLIP-seq
MIRT911777	hsa-miR-363	CLIP-seq
MIRT911778	hsa-miR-365	CLIP-seq
MIRT911779	hsa-miR-367	CLIP-seq
MIRT911780	hsa-miR-3673	CLIP-seq
MIRT911781	hsa-miR-3689d	CLIP-seq
MIRT911782	hsa-miR-382	CLIP-seq
MIRT911783	hsa-miR-3913-3p	CLIP-seq
MIRT911784	hsa-miR-4262	CLIP-seq
MIRT911785	hsa-miR-4291	CLIP-seq
MIRT911786	hsa-miR-4420	CLIP-seq
MIRT911787	hsa-miR-4422	CLIP-seq
MIRT911788	hsa-miR-4446-5p	CLIP-seq
MIRT911789	hsa-miR-4465	CLIP-seq
MIRT911790	hsa-miR-4515	CLIP-seq
MIRT911791	hsa-miR-4645-5p	CLIP-seq
MIRT911792	hsa-miR-4673	CLIP-seq
MIRT911793	hsa-miR-4718	CLIP-seq
MIRT911794	hsa-miR-4755-5p	CLIP-seq
MIRT911795	hsa-miR-4791	CLIP-seq
MIRT911796	hsa-miR-499-3p	CLIP-seq
MIRT911797	hsa-miR-499a-3p	CLIP-seq
MIRT911798	hsa-miR-543	CLIP-seq
MIRT911799	hsa-miR-623	CLIP-seq
MIRT911800	hsa-miR-761	CLIP-seq
MIRT911801	hsa-miR-889	CLIP-seq
MIRT911802	hsa-miR-922	CLIP-seq
MIRT911803	hsa-miR-92a	CLIP-seq
MIRT911804	hsa-miR-92b	CLIP-seq
MIRT1970296	hsa-miR-24	CLIP-seq
MIRT1970297	hsa-miR-3074-5p	CLIP-seq
MIRT1970298	hsa-miR-3161	CLIP-seq
MIRT1970299	hsa-miR-3200-5p	CLIP-seq
MIRT1970300	hsa-miR-4264	CLIP-seq
MIRT1970301	hsa-miR-4797-3p	CLIP-seq
MIRT1970302	hsa-miR-486-5p	CLIP-seq
MIRT1970303	hsa-miR-622	CLIP-seq
MIRT911755	hsa-miR-181a	CLIP-seq
MIRT911756	hsa-miR-181b	CLIP-seq
MIRT911757	hsa-miR-181c	CLIP-seq
MIRT911758	hsa-miR-181d	CLIP-seq
MIRT911772	hsa-miR-342-3p	CLIP-seq
MIRT911774	hsa-miR-3613-3p	CLIP-seq
MIRT911784	hsa-miR-4262	CLIP-seq
MIRT2447707	hsa-miR-1976	CLIP-seq
MIRT2447708	hsa-miR-3183	CLIP-seq
MIRT2447709	hsa-miR-378	CLIP-seq
MIRT2447710	hsa-miR-378b	CLIP-seq
MIRT2447711	hsa-miR-378c	CLIP-seq
MIRT2447712	hsa-miR-378d	CLIP-seq
MIRT2447713	hsa-miR-378e	CLIP-seq
MIRT2447714	hsa-miR-378f	CLIP-seq
MIRT2447715	hsa-miR-378h	CLIP-seq
MIRT2447716	hsa-miR-378i	CLIP-seq
MIRT2447717	hsa-miR-422a	CLIP-seq
MIRT2447718	hsa-miR-4638-3p	CLIP-seq
MIRT2447719	hsa-miR-4723-3p	CLIP-seq
MIRT2447720	hsa-miR-760	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004912	Function	Interleukin-3 receptor activity	TAS	9410898
GO:0004914	Function	Interleukin-5 receptor activity	TAS	9410898
GO:0005515	Function	Protein binding	IPI	1495999, 9516124, 16437163, 17828305, 18692472, 20802515, 29374162
GO:0005886	Component	Plasma membrane	IDA	1495999
GO:0005886	Component	Plasma membrane	NAS	1396555
GO:0005886	Component	Plasma membrane	NAS	1702217
GO:0005886	Component	Plasma membrane	TAS	7556069
GO:0007165	Process	Signal transduction	NAS	1702217, 1833065
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	18692472
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	TAS	9410898
GO:0009897	Component	External side of plasma membrane	IBA
GO:0015026	Function	Coreceptor activity	IDA	7957082, 8649415
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0030526	Component	Granulocyte macrophage colony-stimulating factor receptor complex	IDA	27396825
GO:0030526	Component	Granulocyte macrophage colony-stimulating factor receptor complex	TAS	9410898
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0036016	Process	Cellular response to interleukin-3	IEA
GO:0038023	Function	Signaling receptor activity	TAS	9410898
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IBA
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	7613138
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	1495999
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IBA
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IDA	8007942
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IDA	8649415
GO:0038157	Process	Granulocyte-macrophage colony-stimulating factor signaling pathway	IBA
GO:0038157	Process	Granulocyte-macrophage colony-stimulating factor signaling pathway	IDA	18692472
GO:0070665	Process	Positive regulation of leukocyte proliferation	IBA
GO:0070665	Process	Positive regulation of leukocyte proliferation	IDA	18692472

MIM	HGNC	e!Ensembl
138981	2436	ENSG00000100368

P32927

Protein name

Cytokine receptor common subunit beta (CDw131) (GM-CSF/IL-3/IL-5 receptor common beta subunit) (CD antigen CD131)

Protein function

Cell surface receptor that plays a role in immune response and controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Acts by forming an heterodimeric receptor through interaction with differ

PDB

1C8P , 1EGJ , 1GH7 , 2GYS , 2NA8 , 2NA9 , 4NKQ , 5DWU , 8TLD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09294	Interfer-bind	323 → 430	Interferon-alpha/beta receptor, fibronectin type III	Domain

Sequence

MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC

Sequence length

897

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Apoptosis JAK-STAT signaling pathway Pathways in cancer		Interleukin-3, Interleukin-5 and GM-CSF signaling RAF/MAP kinase cascade Surfactant metabolism Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5) Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4) Interleukin receptor SHC signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
CSF2RB-related disorder	Likely pathogenic	rs769513501	RCV003419100	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Surfactant metabolism dysfunction, pulmonary, 5	Pathogenic	rs2517990619	RCV000022596	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ALVEOLAR PROTEINOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY ALVEOLAR PROTEINOSIS, CONGENITAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SURFACTANT DYSFUNCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	27377463		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha Thalassemia	Alpha thalassemia	Pubtator	3337909	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27821400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27821400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34122426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36532080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	8417793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34729943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29516317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27373512, 27377463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27373512, 27377463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36154667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dominant beta-thalassemia	beta Thalassemia	BEFREE	15977037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobin SC Disease	Hemoglobin sc disease	Pubtator	9326250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	Pubtator	8178823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pulmonary alveolar proteinosis	Hereditary Pulmonary Alveolar Proteinosis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36451838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15928038, 34729943, 9414269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20007544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	39298477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	9410898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37335631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	36532080	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	21247258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28178938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	36532080	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11122148	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	24631628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	34122426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	11930665, 21075760, 30100408, 30846703		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	GENOMICS_ENGLAND_DG	15331184, 21075760		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	9410898	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary alveolar proteinosis, congenital	Congenital pulmonary alveolar proteinosis	ORPHANET_DG	21075760, 21205713		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	26787464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic Seasonal	Seasonal allergic rhinitis	Pubtator	21071541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19036083		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	17667962, 18547720, 21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17667962, 18547720, 21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39331939	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38425243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Surfactant Dysfunction	Pulmonary surfactant metabolism dysfunction	Pubtator	33526882	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 5	Surfactant Metabolism Dysfunction, Pulmonary	GENOMICS_ENGLAND_DG	15331184, 21075760		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 5	Surfactant Metabolism Dysfunction, Pulmonary	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SURFACTANT METABOLISM DYSFUNCTION, PULMONARY, 5	Surfactant Metabolism Dysfunction, Pulmonary	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unipolar Depression	Mental Depression	BEFREE	21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21247258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21071541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CSF2RB (colony stimulating factor 2 receptor subunit beta)