Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	143684
Gene name	Family with sequence similarity 76 member B
Gene symbol	FAM76B
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q21

208

Show/Hide all (208)

miRTarBase ID	miRNA	Experiments
MIRT987345	hsa-miR-1183	CLIP-seq
MIRT987346	hsa-miR-1244	CLIP-seq
MIRT987347	hsa-miR-1245b-3p	CLIP-seq
MIRT987348	hsa-miR-132	CLIP-seq
MIRT987349	hsa-miR-194	CLIP-seq
MIRT987350	hsa-miR-200b	CLIP-seq
MIRT987351	hsa-miR-200c	CLIP-seq
MIRT987352	hsa-miR-203	CLIP-seq
MIRT987353	hsa-miR-204	CLIP-seq
MIRT987354	hsa-miR-211	CLIP-seq
MIRT987355	hsa-miR-212	CLIP-seq
MIRT987356	hsa-miR-27a	CLIP-seq
MIRT987357	hsa-miR-27b	CLIP-seq
MIRT987358	hsa-miR-3158-3p	CLIP-seq
MIRT987359	hsa-miR-3177-5p	CLIP-seq
MIRT987360	hsa-miR-3182	CLIP-seq
MIRT987361	hsa-miR-338-5p	CLIP-seq
MIRT987362	hsa-miR-3613-3p	CLIP-seq
MIRT987363	hsa-miR-3662	CLIP-seq
MIRT987364	hsa-miR-3686	CLIP-seq
MIRT987365	hsa-miR-374c	CLIP-seq
MIRT987366	hsa-miR-377	CLIP-seq
MIRT987367	hsa-miR-421	CLIP-seq
MIRT987368	hsa-miR-4280	CLIP-seq
MIRT987369	hsa-miR-429	CLIP-seq
MIRT987370	hsa-miR-4328	CLIP-seq
MIRT987371	hsa-miR-4477b	CLIP-seq
MIRT987372	hsa-miR-4511	CLIP-seq
MIRT987373	hsa-miR-452	CLIP-seq
MIRT987374	hsa-miR-4661-5p	CLIP-seq
MIRT987375	hsa-miR-4666-5p	CLIP-seq
MIRT987376	hsa-miR-4676-3p	CLIP-seq
MIRT987377	hsa-miR-4698	CLIP-seq
MIRT987378	hsa-miR-4709-5p	CLIP-seq
MIRT987379	hsa-miR-4719	CLIP-seq
MIRT987380	hsa-miR-4724-3p	CLIP-seq
MIRT987381	hsa-miR-4725-5p	CLIP-seq
MIRT987382	hsa-miR-4729	CLIP-seq
MIRT987383	hsa-miR-4755-5p	CLIP-seq
MIRT987384	hsa-miR-483-3p	CLIP-seq
MIRT987385	hsa-miR-504	CLIP-seq
MIRT987386	hsa-miR-505	CLIP-seq
MIRT987387	hsa-miR-513a-5p	CLIP-seq
MIRT987388	hsa-miR-520d-5p	CLIP-seq
MIRT987389	hsa-miR-524-5p	CLIP-seq
MIRT987390	hsa-miR-548a-5p	CLIP-seq
MIRT987391	hsa-miR-548ab	CLIP-seq
MIRT987392	hsa-miR-548ak	CLIP-seq
MIRT987393	hsa-miR-548b-3p	CLIP-seq
MIRT987394	hsa-miR-548b-5p	CLIP-seq
MIRT987395	hsa-miR-548c-5p	CLIP-seq
MIRT987396	hsa-miR-548d-5p	CLIP-seq
MIRT987397	hsa-miR-548h	CLIP-seq
MIRT987398	hsa-miR-548i	CLIP-seq
MIRT987399	hsa-miR-548j	CLIP-seq
MIRT987400	hsa-miR-548n	CLIP-seq
MIRT987401	hsa-miR-548w	CLIP-seq
MIRT987402	hsa-miR-548y	CLIP-seq
MIRT987403	hsa-miR-559	CLIP-seq
MIRT987404	hsa-miR-576-3p	CLIP-seq
MIRT987405	hsa-miR-586	CLIP-seq
MIRT987406	hsa-miR-623	CLIP-seq
MIRT987407	hsa-miR-627	CLIP-seq
MIRT987408	hsa-miR-655	CLIP-seq
MIRT987409	hsa-miR-891b	CLIP-seq
MIRT987345	hsa-miR-1183	CLIP-seq
MIRT987347	hsa-miR-1245b-3p	CLIP-seq
MIRT987348	hsa-miR-132	CLIP-seq
MIRT987355	hsa-miR-212	CLIP-seq
MIRT1992599	hsa-miR-298	CLIP-seq
MIRT1992600	hsa-miR-3158-5p	CLIP-seq
MIRT987359	hsa-miR-3177-5p	CLIP-seq
MIRT1992601	hsa-miR-3194-3p	CLIP-seq
MIRT1992602	hsa-miR-337-3p	CLIP-seq
MIRT987361	hsa-miR-338-5p	CLIP-seq
MIRT1992603	hsa-miR-345	CLIP-seq
MIRT1992604	hsa-miR-3607-5p	CLIP-seq
MIRT1992605	hsa-miR-3647-3p	CLIP-seq
MIRT1992606	hsa-miR-374a	CLIP-seq
MIRT1992607	hsa-miR-374b	CLIP-seq
MIRT987367	hsa-miR-421	CLIP-seq
MIRT1992608	hsa-miR-4418	CLIP-seq
MIRT1992609	hsa-miR-4420	CLIP-seq
MIRT1992610	hsa-miR-448	CLIP-seq
MIRT987375	hsa-miR-4666-5p	CLIP-seq
MIRT987377	hsa-miR-4698	CLIP-seq
MIRT987378	hsa-miR-4709-5p	CLIP-seq
MIRT987380	hsa-miR-4724-3p	CLIP-seq
MIRT1992611	hsa-miR-4766-5p	CLIP-seq
MIRT1992612	hsa-miR-4795-3p	CLIP-seq
MIRT1992613	hsa-miR-4804-3p	CLIP-seq
MIRT987386	hsa-miR-505	CLIP-seq
MIRT1992614	hsa-miR-509-3-5p	CLIP-seq
MIRT1992615	hsa-miR-509-5p	CLIP-seq
MIRT987404	hsa-miR-576-3p	CLIP-seq
MIRT1992616	hsa-miR-617	CLIP-seq
MIRT1992617	hsa-miR-944	CLIP-seq
MIRT2226564	hsa-miR-101	CLIP-seq
MIRT2226565	hsa-miR-1231	CLIP-seq
MIRT2226566	hsa-miR-124	CLIP-seq
MIRT987346	hsa-miR-1244	CLIP-seq
MIRT987347	hsa-miR-1245b-3p	CLIP-seq
MIRT2226567	hsa-miR-1284	CLIP-seq
MIRT987348	hsa-miR-132	CLIP-seq
MIRT2226568	hsa-miR-139-5p	CLIP-seq
MIRT2226569	hsa-miR-144	CLIP-seq
MIRT2226570	hsa-miR-186	CLIP-seq
MIRT2226571	hsa-miR-199a-3p	CLIP-seq
MIRT2226572	hsa-miR-199b-3p	CLIP-seq
MIRT987355	hsa-miR-212	CLIP-seq
MIRT2226573	hsa-miR-216a	CLIP-seq
MIRT2226574	hsa-miR-216b	CLIP-seq
MIRT2226575	hsa-miR-3074-3p	CLIP-seq
MIRT2226576	hsa-miR-3129-5p	CLIP-seq
MIRT2226577	hsa-miR-3168	CLIP-seq
MIRT987359	hsa-miR-3177-5p	CLIP-seq
MIRT1992602	hsa-miR-337-3p	CLIP-seq
MIRT1992604	hsa-miR-3607-5p	CLIP-seq
MIRT2226578	hsa-miR-361-5p	CLIP-seq
MIRT1992605	hsa-miR-3647-3p	CLIP-seq
MIRT987365	hsa-miR-374c	CLIP-seq
MIRT2226579	hsa-miR-380	CLIP-seq
MIRT987367	hsa-miR-421	CLIP-seq
MIRT2226580	hsa-miR-4288	CLIP-seq
MIRT2226581	hsa-miR-4438	CLIP-seq
MIRT2226582	hsa-miR-4470	CLIP-seq
MIRT987373	hsa-miR-452	CLIP-seq
MIRT987375	hsa-miR-4666-5p	CLIP-seq
MIRT987376	hsa-miR-4676-3p	CLIP-seq
MIRT2226583	hsa-miR-4694-3p	CLIP-seq
MIRT987377	hsa-miR-4698	CLIP-seq
MIRT987378	hsa-miR-4709-5p	CLIP-seq
MIRT1992611	hsa-miR-4766-5p	CLIP-seq
MIRT2226584	hsa-miR-4796-5p	CLIP-seq
MIRT2226585	hsa-miR-4799-5p	CLIP-seq
MIRT1992613	hsa-miR-4804-3p	CLIP-seq
MIRT987386	hsa-miR-505	CLIP-seq
MIRT2226586	hsa-miR-506	CLIP-seq
MIRT987388	hsa-miR-520d-5p	CLIP-seq
MIRT987389	hsa-miR-524-5p	CLIP-seq
MIRT2226587	hsa-miR-548ac	CLIP-seq
MIRT2226588	hsa-miR-548ae	CLIP-seq
MIRT2226589	hsa-miR-548aj	CLIP-seq
MIRT2226590	hsa-miR-548am	CLIP-seq
MIRT2226591	hsa-miR-548c-3p	CLIP-seq
MIRT2226592	hsa-miR-548d-3p	CLIP-seq
MIRT2226593	hsa-miR-548x	CLIP-seq
MIRT2226594	hsa-miR-548z	CLIP-seq
MIRT987404	hsa-miR-576-3p	CLIP-seq
MIRT987405	hsa-miR-586	CLIP-seq
MIRT2226595	hsa-miR-607	CLIP-seq
MIRT2226596	hsa-miR-632	CLIP-seq
MIRT987408	hsa-miR-655	CLIP-seq
MIRT2226597	hsa-miR-935	CLIP-seq
MIRT1992617	hsa-miR-944	CLIP-seq
MIRT987365	hsa-miR-374c	CLIP-seq
MIRT987408	hsa-miR-655	CLIP-seq
MIRT2530554	hsa-miR-137	CLIP-seq
MIRT2226570	hsa-miR-186	CLIP-seq
MIRT2530555	hsa-miR-25	CLIP-seq
MIRT2530556	hsa-miR-3160-5p	CLIP-seq
MIRT2530557	hsa-miR-3163	CLIP-seq
MIRT2530558	hsa-miR-32	CLIP-seq
MIRT2530559	hsa-miR-323-3p	CLIP-seq
MIRT2530560	hsa-miR-363	CLIP-seq
MIRT2530561	hsa-miR-367	CLIP-seq
MIRT2530562	hsa-miR-409-3p	CLIP-seq
MIRT2530563	hsa-miR-4272	CLIP-seq
MIRT2530564	hsa-miR-4680-3p	CLIP-seq
MIRT2226583	hsa-miR-4694-3p	CLIP-seq
MIRT987377	hsa-miR-4698	CLIP-seq
MIRT987380	hsa-miR-4724-3p	CLIP-seq
MIRT1992612	hsa-miR-4795-3p	CLIP-seq
MIRT2530565	hsa-miR-494	CLIP-seq
MIRT2530566	hsa-miR-513a-3p	CLIP-seq
MIRT987388	hsa-miR-520d-5p	CLIP-seq
MIRT987389	hsa-miR-524-5p	CLIP-seq
MIRT2530567	hsa-miR-548a-3p	CLIP-seq
MIRT2530568	hsa-miR-548ag	CLIP-seq
MIRT2530569	hsa-miR-548ai	CLIP-seq
MIRT2530570	hsa-miR-548e	CLIP-seq
MIRT2530571	hsa-miR-548f	CLIP-seq
MIRT2530572	hsa-miR-548m	CLIP-seq
MIRT2226595	hsa-miR-607	CLIP-seq
MIRT2530573	hsa-miR-889	CLIP-seq
MIRT2530574	hsa-miR-92a	CLIP-seq
MIRT2530575	hsa-miR-92b	CLIP-seq
MIRT2530554	hsa-miR-137	CLIP-seq
MIRT987350	hsa-miR-200b	CLIP-seq
MIRT987351	hsa-miR-200c	CLIP-seq
MIRT2530557	hsa-miR-3163	CLIP-seq
MIRT2530559	hsa-miR-323-3p	CLIP-seq
MIRT987365	hsa-miR-374c	CLIP-seq
MIRT2530562	hsa-miR-409-3p	CLIP-seq
MIRT2530563	hsa-miR-4272	CLIP-seq
MIRT987369	hsa-miR-429	CLIP-seq
MIRT987373	hsa-miR-452	CLIP-seq
MIRT987376	hsa-miR-4676-3p	CLIP-seq
MIRT2530565	hsa-miR-494	CLIP-seq
MIRT2530566	hsa-miR-513a-3p	CLIP-seq
MIRT987388	hsa-miR-520d-5p	CLIP-seq
MIRT987389	hsa-miR-524-5p	CLIP-seq
MIRT2530568	hsa-miR-548ag	CLIP-seq
MIRT2530569	hsa-miR-548ai	CLIP-seq
MIRT2530572	hsa-miR-548m	CLIP-seq
MIRT2226595	hsa-miR-607	CLIP-seq
MIRT987408	hsa-miR-655	CLIP-seq
MIRT2530573	hsa-miR-889	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 33961781, 37643469
GO:0005634	Component	Nucleus	IEA
GO:0016607	Component	Nuclear speck	IBA
GO:0016607	Component	Nuclear speck	IDA	19266028, 27018871
GO:0016607	Component	Nuclear speck	IEA
GO:0043031	Process	Negative regulation of macrophage activation	IEA
GO:0043031	Process	Negative regulation of macrophage activation	IMP	38421448
GO:0046826	Process	Negative regulation of protein export from nucleus	IMP	37643469
GO:0048255	Process	MRNA stabilization	IMP	38421448
GO:0050728	Process	Negative regulation of inflammatory response	IMP	37643469

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5HYJ3

Protein name

Protein FAM76B

Protein function

Negatively regulates the NF-kappa-B-mediated inflammatory pathway by preventing the translocation of HNRNPA2B1 from the nucleus to the cytoplasm (PubMed:37643469). Inhibits the PI3K/Akt/NF-kappa-B pathway-mediated polarization of M1 macrophages

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16046	FAM76	6 → 328	FAM76 protein	Family

Sequence

MAASALYACTKCTQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKKC
AQNVKQFGTPKPCQYCNIIAAFIGTKCQRCTNSEKKYGPPQTCEQCKQQCAFDRKEEGRR
KVDGKLLCWLCTLSYKRVLQKTKEQRKSLGSSHSNSSSSSLTEKDQHHPKHHHHHHHHHH
RHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADS
GGTDNFVLISQLKEEVMSLKRLLQQRDQTILEKDKKLTELKADFQYQESNLRTKMNSMEK
AHKETVEQLQAKNRELLKQVAALSKGKKFDKSGSILTSP

Sequence length

339

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (47)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HASHIMOTO'S THYROIDITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATOCONUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYASTHENIA GRAVIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FAM76B (family with sequence similarity 76 member B)