CSF1 (colony stimulating factor 1)

Gene

• Entrez ID: 1435
• Gene name: Colony stimulating factor 1
• Gene symbol: CSF1
• Synonyms (NCBI Gene): CSF-1, MCSF, PG-M-CSF
• Chromosome: 1
• Chromosome location: 1p13.3
• Summary: The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolyti

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay, Western blot	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay, Western blot	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay	18823650
MIRT004575	hsa-miR-130a-3p	Luciferase reporter assay	14697198
MIRT006200	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, qRT-PCR	22005523
MIRT006200	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, qRT-PCR	22005523
MIRT006200	hsa-miR-130b-3p	ELISA, Luciferase reporter assay, qRT-PCR	22005523
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT007318	hsa-miR-148b-3p	Western blot	23238785
MIRT016979	hsa-miR-335-5p	Microarray	18185580
MIRT004575	hsa-miR-130a-3p	Reporter assay	14697198
MIRT047860	hsa-miR-30c-5p	CLASH	23622248
MIRT046121	hsa-miR-30b-5p	CLASH	23622248
MIRT041071	hsa-miR-505-3p	CLASH	23622248
MIRT052998	hsa-miR-128-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT052998	hsa-miR-128-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT053188	hsa-miR-152-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT052998	hsa-miR-128-3p	Flow, qRT-PCR, Western blot	23019226
MIRT052998	hsa-miR-128-3p	Luciferase reporter assay, Western blot	24415783
MIRT053188	hsa-miR-152-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22909061
MIRT007318	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007318	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007318	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT569797	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT569796	hsa-miR-3135b	PAR-CLIP	20371350
MIRT569795	hsa-miR-5580-5p	PAR-CLIP	20371350
MIRT569794	hsa-miR-184	PAR-CLIP	20371350
MIRT569793	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT569791	hsa-miR-4306	PAR-CLIP	20371350
MIRT569792	hsa-miR-4644	PAR-CLIP	20371350
MIRT569790	hsa-miR-5192	PAR-CLIP	20371350
MIRT569789	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569788	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT569787	hsa-miR-765	PAR-CLIP	20371350
MIRT569786	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT569785	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT732200	hsa-miR-1207-5p	5.0	27107415
MIRT732200	hsa-miR-1207-5p	5.0	27107415
MIRT732200	hsa-miR-1207-5p	5.0	27107415
MIRT569797	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT569796	hsa-miR-3135b	PAR-CLIP	20371350
MIRT569795	hsa-miR-5580-5p	PAR-CLIP	20371350
MIRT569794	hsa-miR-184	PAR-CLIP	20371350
MIRT569793	hsa-miR-185-5p	PAR-CLIP	20371350
MIRT569791	hsa-miR-4306	PAR-CLIP	20371350
MIRT569792	hsa-miR-4644	PAR-CLIP	20371350
MIRT569790	hsa-miR-5192	PAR-CLIP	20371350
MIRT569789	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569788	hsa-miR-7154-3p	PAR-CLIP	20371350
MIRT569787	hsa-miR-765	PAR-CLIP	20371350
MIRT569786	hsa-miR-6894-5p	PAR-CLIP	20371350
MIRT569785	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT911659	hsa-miR-1972	CLIP-seq
MIRT911660	hsa-miR-4650-5p	CLIP-seq
MIRT911661	hsa-miR-4681	CLIP-seq
MIRT911662	hsa-miR-148a	CLIP-seq
MIRT911663	hsa-miR-148b	CLIP-seq
MIRT911664	hsa-miR-152	CLIP-seq
MIRT911665	hsa-miR-198	CLIP-seq
MIRT911666	hsa-miR-214	CLIP-seq
MIRT911667	hsa-miR-223	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT911670	hsa-miR-3166	CLIP-seq
MIRT911671	hsa-miR-3619-5p	CLIP-seq
MIRT911672	hsa-miR-3620	CLIP-seq
MIRT911673	hsa-miR-4284	CLIP-seq
MIRT911674	hsa-miR-4300	CLIP-seq
MIRT911675	hsa-miR-4437	CLIP-seq
MIRT911676	hsa-miR-4530	CLIP-seq
MIRT911677	hsa-miR-4537	CLIP-seq
MIRT911678	hsa-miR-4685-5p	CLIP-seq
MIRT911679	hsa-miR-4697-3p	CLIP-seq
MIRT911680	hsa-miR-4771	CLIP-seq
MIRT911681	hsa-miR-483-3p	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT911683	hsa-miR-520a-5p	CLIP-seq
MIRT911684	hsa-miR-525-5p	CLIP-seq
MIRT911685	hsa-miR-634	CLIP-seq
MIRT911686	hsa-miR-761	CLIP-seq
MIRT911687	hsa-miR-920	CLIP-seq
MIRT1970282	hsa-miR-1228	CLIP-seq
MIRT1970283	hsa-miR-1247	CLIP-seq
MIRT1970284	hsa-miR-1266	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT1970285	hsa-miR-3664-3p	CLIP-seq
MIRT1970286	hsa-miR-4518	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT1970283	hsa-miR-1247	CLIP-seq
MIRT2206213	hsa-miR-1268	CLIP-seq
MIRT2206214	hsa-miR-1268b	CLIP-seq
MIRT2206215	hsa-miR-23a	CLIP-seq
MIRT2206216	hsa-miR-23b	CLIP-seq
MIRT2206217	hsa-miR-23c	CLIP-seq
MIRT2206218	hsa-miR-4486	CLIP-seq
MIRT2206219	hsa-miR-4492	CLIP-seq
MIRT2206220	hsa-miR-4498	CLIP-seq
MIRT2206221	hsa-miR-4505	CLIP-seq
MIRT2206222	hsa-miR-4508	CLIP-seq
MIRT2206223	hsa-miR-585	CLIP-seq
MIRT2206224	hsa-miR-762	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT2436480	hsa-miR-1200	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT2436481	hsa-miR-4763-3p	CLIP-seq
MIRT2436482	hsa-miR-544b	CLIP-seq
MIRT2509433	hsa-miR-125a-5p	CLIP-seq
MIRT2509434	hsa-miR-125b	CLIP-seq
MIRT2509435	hsa-miR-3126-5p	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT2509436	hsa-miR-3165	CLIP-seq
MIRT2509437	hsa-miR-3183	CLIP-seq
MIRT2509438	hsa-miR-326	CLIP-seq
MIRT2509439	hsa-miR-330-5p	CLIP-seq
MIRT2509440	hsa-miR-3616-3p	CLIP-seq
MIRT2509441	hsa-miR-3944-5p	CLIP-seq
MIRT2509442	hsa-miR-4268	CLIP-seq
MIRT2509443	hsa-miR-4319	CLIP-seq
MIRT2509444	hsa-miR-4419a	CLIP-seq
MIRT2509445	hsa-miR-4436b-3p	CLIP-seq
MIRT2509446	hsa-miR-4456	CLIP-seq
MIRT2509447	hsa-miR-4459	CLIP-seq
MIRT2509448	hsa-miR-4510	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2509449	hsa-miR-4723-3p	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT2509450	hsa-miR-4779	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT2436482	hsa-miR-544b	CLIP-seq
MIRT2509451	hsa-miR-665	CLIP-seq
MIRT2509452	hsa-miR-940	CLIP-seq
MIRT2678685	hsa-miR-128	CLIP-seq
MIRT2678686	hsa-miR-130a	CLIP-seq
MIRT2678687	hsa-miR-130b	CLIP-seq
MIRT911662	hsa-miR-148a	CLIP-seq
MIRT911663	hsa-miR-148b	CLIP-seq
MIRT911664	hsa-miR-152	CLIP-seq
MIRT2678688	hsa-miR-1909	CLIP-seq
MIRT2678689	hsa-miR-27a	CLIP-seq
MIRT2678690	hsa-miR-27b	CLIP-seq
MIRT2678691	hsa-miR-301a	CLIP-seq
MIRT2678692	hsa-miR-301b	CLIP-seq
MIRT911668	hsa-miR-3155	CLIP-seq
MIRT911669	hsa-miR-3155b	CLIP-seq
MIRT2509436	hsa-miR-3165	CLIP-seq
MIRT2509437	hsa-miR-3183	CLIP-seq
MIRT2509438	hsa-miR-326	CLIP-seq
MIRT2509439	hsa-miR-330-5p	CLIP-seq
MIRT2509440	hsa-miR-3616-3p	CLIP-seq
MIRT2678693	hsa-miR-3666	CLIP-seq
MIRT2678694	hsa-miR-4255	CLIP-seq
MIRT2509442	hsa-miR-4268	CLIP-seq
MIRT2678695	hsa-miR-4295	CLIP-seq
MIRT2509445	hsa-miR-4436b-3p	CLIP-seq
MIRT2509446	hsa-miR-4456	CLIP-seq
MIRT2509447	hsa-miR-4459	CLIP-seq
MIRT2386495	hsa-miR-4514	CLIP-seq
MIRT2678696	hsa-miR-454	CLIP-seq
MIRT2678697	hsa-miR-4645-5p	CLIP-seq
MIRT2678698	hsa-miR-4673	CLIP-seq
MIRT2386496	hsa-miR-4692	CLIP-seq
MIRT2509449	hsa-miR-4723-3p	CLIP-seq
MIRT2678699	hsa-miR-4733-3p	CLIP-seq
MIRT2386497	hsa-miR-4736	CLIP-seq
MIRT911682	hsa-miR-484	CLIP-seq
MIRT2678700	hsa-miR-513a-5p	CLIP-seq
MIRT2509451	hsa-miR-665	CLIP-seq
MIRT2509452	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ABL1	Activation	23418320
ABL1	Unknown	18619508
CEBPA	Unknown	9632776
JUN	Activation	7642615
NFKB1	Activation	18566389
NFKB1	Unknown	11949945
PPARG	Repression	18566389
RELA	Activation	18566389
RELA	Unknown	11949945
RUNX1	Unknown	9632776
SPI1	Unknown	9632776

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001780	Process	Neutrophil homeostasis	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0001954	Process	Positive regulation of cell-matrix adhesion	ISS	18566389
GO:0002158	Process	Osteoclast proliferation	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0002687	Process	Positive regulation of leukocyte migration	IEA
GO:0002931	Process	Response to ischemia	IDA	8922060
GO:0003006	Process	Developmental process involved in reproduction	IEA
GO:0003006	Process	Developmental process involved in reproduction	ISS	19017797
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	2460758, 10652277
GO:0005125	Function	Cytokine activity	IEA
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	IEA
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	ISS	19017797
GO:0005157	Function	Macrophage colony-stimulating factor receptor binding	TAS	2460758
GO:0005515	Function	Protein binding	IPI	22153499, 22483114, 22826234, 22902366, 25416956, 26235028, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	2460758
GO:0005615	Component	Extracellular space	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006954	Process	Inflammatory response	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IDA	19100238
GO:0007265	Process	Ras protein signal transduction	IEA
GO:0008083	Function	Growth factor activity	IDA	2460758
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10652277
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	2460758
GO:0010628	Process	Positive regulation of gene expression	IDA	1739124, 10666185
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010743	Process	Regulation of macrophage derived foam cell differentiation	NAS	18566389
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IDA	17244792
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IDA	19100238
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	2460758
GO:0016604	Component	Nuclear body	IDA
GO:0030224	Process	Monocyte differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	TAS	2460758
GO:0030278	Process	Regulation of ossification	IEA
GO:0030316	Process	Osteoclast differentiation	IBA
GO:0030316	Process	Osteoclast differentiation	IDA	18606301
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030316	Process	Osteoclast differentiation	IEA
GO:0030335	Process	Positive regulation of cell migration	ISS	18566389
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IDA	2460758
GO:0035702	Process	Monocyte homeostasis	IEA
GO:0038145	Process	Macrophage colony-stimulating factor signaling pathway	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042117	Process	Monocyte activation	NAS	18566389
GO:0042488	Process	Positive regulation of odontogenesis of dentin-containing tooth	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	22153499, 22902366
GO:0042803	Function	Protein homodimerization activity	IDA	3264878
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	IBA
GO:0045651	Process	Positive regulation of macrophage differentiation	IDA	2460758
GO:0045651	Process	Positive regulation of macrophage differentiation	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	IEA
GO:0045657	Process	Positive regulation of monocyte differentiation	ISS	18566389
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	15304486
GO:0045672	Process	Positive regulation of osteoclast differentiation	IEA
GO:0046579	Process	Positive regulation of Ras protein signal transduction	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	1739124
GO:0048873	Process	Homeostasis of number of cells within a tissue	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IDA	1739124
GO:0060444	Process	Branching involved in mammary gland duct morphogenesis	IEA
GO:0060611	Process	Mammary gland fat development	IEA
GO:0060763	Process	Mammary duct terminal end bud growth	IEA
GO:0061518	Process	Microglial cell proliferation	IEA
GO:0061519	Process	Macrophage homeostasis	IEA
GO:0097529	Process	Myeloid leukocyte migration	IEA
GO:1902228	Process	Positive regulation of macrophage colony-stimulating factor signaling pathway	IDA	19100238
GO:1904141	Process	Positive regulation of microglial cell migration	IDA	19100238
GO:1905523	Process	Positive regulation of macrophage migration	IMP	24415783
GO:1990682	Component	CSF1-CSF1R complex	IEA
GO:1990682	Component	CSF1-CSF1R complex	ISS	19017797

Other IDs

• MIM: 120420
• HGNC: 2432
• e!Ensembl: ENSG00000184371

Protein

• UniProt ID: P09603
• Protein name: Macrophage colony-stimulating factor 1 (CSF-1) (M-CSF) (MCSF) (Lanimostim) (Proteoglycan macrophage colony-stimulating factor) (PG-M-CSF) [Cleaved into: Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subuni
• Protein function: Cytokine that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. Promotes the release of pro-inflammato
• PDB: 1HMC, 3UEZ, 3UF2, 4ADF, 4FA8, 4WRL, 4WRM, 5LXF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05337	CSF-1	41 → 180	Macrophage colony stimulating factor-1 (CSF-1)	Domain

• Sequence:

  MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
  TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
  SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
  QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
  LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
  TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
  DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
  AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
  HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
  SPLTQDDRQVELPV

• Sequence length: 554

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
PI3K-Akt signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
TNF signaling pathway
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Rheumatoid arthritis

Reactome:

Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Other interleukin signaling
Interleukin-10 signaling
Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERSTITIAL CYSTITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acidosis Lactic	Lactic acidosis	Pubtator	31924656	Associate	★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	30580386		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	2465043		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	2154646		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	1695482, 23870818, 7965406, 9815987		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	31731509		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	16844084, 28753101		★☆☆☆☆ Found in Text Mining only
Alveolitis Extrinsic Allergic	Extrinsic allergic alveolitis	Pubtator	37833889	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21942811, 32255787	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	18389210	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	32586411	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	3495006	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	26539497	Stimulate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	15478146		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28697890		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28697890		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	17321344	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30336142		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic disease	Pubtator	22479353	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21159337		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28934972, 30120124, 3263464		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33679701, 35255727	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	20796300	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12384915, 15485996, 25652333, 34239365, 38283352	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37249291	Stimulate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	40696647	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	15919699		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19008293, 20335529, 40489880, 7622526	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21159337		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	8394386	Inhibit	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	29895319		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	LHGDN	15728521		★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	21467819, 25302610, 30417373	Associate	★☆☆☆☆ Found in Text Mining only
Bone Resorption	Bone resorption	Pubtator	8916970	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1334964, 14709771, 15205327, 15289345, 15679045, 16618760, 16927019, 17172715, 1829808, 19188147, 20593409, 20876703, 22096574, 22678116, 23911287, 24013225, 24263966, 24769444, 24956020, 27599777, 28463564, 29796177, 31217507, 8981366, 9500466		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16618760		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11956031, 19188147, 19949854, 23233531, 24342436, 35456396	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	27821504		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	39237660	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	15117969, 2663797	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17332318, 25446896, 31565097		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	24263966	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35637248, 37097499, 38015590	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39173282	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24468794, 27107415, 2973787, 8543387, 8869967		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	9376277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32173982	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	11092615, 25886010, 29734839, 34002666	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	9845545	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15867372, 18708368, 18823650, 19177198, 22005523, 22909061, 22988839, 2973787, 7965406, 8698627, 9815777		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19004987		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	19004987		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	20796300	Associate	★☆☆☆☆ Found in Text Mining only
Catatonia	Catatonia	BEFREE	29252214		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	21895511	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	10072108	Stimulate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17332318		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17332318		★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	22094537		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	2973787, 8188522		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	24592910		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26762581		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29319809		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	34652888	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	31710624		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12235002		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20593409, 24737547		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17368603		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	34146579	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18436538		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29734839		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	30012324		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	22780915, 24699314, 37304261	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30012324		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30012324	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30012324		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28273887, 31710624		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28273887	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	25854167		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28697890		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	28821884	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	28821884		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29501441		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29501441		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	35281591	Associate	★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	25365709		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	28821884		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	9815987		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	24263966, 30816518, 9815987		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	2663797, 30816518, 35762530, 8605095	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15550065, 21481374, 22365076, 28071833		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	21481374, 22365076	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	39342173	Inhibit	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15867372, 19177198, 9815777		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	22096574		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37676642	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Essential tremor	Pubtator	36266510	Associate	★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	24263966		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26762581		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21171987		★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	29501441		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	39817309	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	36007098	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	16407111, 19443701, 24604026, 26222558, 27041409, 30152874, 30206409, 30594158, 34716196, 34855235, 35443852, 36007098, 36099115, 36320082, 36502356, 36504457	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Tendon Sheath	Giant cell tumor of tendon sheath	Pubtator	19188147	Stimulate	★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	28474967, 28753101		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21649900, 26245897	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28459367		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10066091, 11357885, 31696484		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17318194, 22957741, 26245897	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	37876929	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	22905158	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	18436538		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	28438094	Stimulate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	1912583	Associate	★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	LHGDN	11843897		★☆☆☆☆ Found in Text Mining only
Hematological Disease	Hematological Disease	BEFREE	3497400		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	9067911	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	30650445	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Autoimmune	Autoimmune hepatitis	Pubtator	37108648	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	32393308	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Leukoencephalopathy with Spheroids	Hereditary Diffuse Leukoencephalopathy With Spheroids	BEFREE	24120500, 24145216, 26443621		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	LHGDN	15728521		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	1632458	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	2156611, 31731509		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	8188522		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	8188522	Associate	★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	8188522		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25420919, 8781300		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28438094	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33737938	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31732480		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	33746960	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27898738, 28263993		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	27898738, 28263993	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	29930294		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	30326776		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	21822305		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12110011	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	19926892		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11369790		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11369790	Associate	★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	21854753		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	19443701	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	21854753		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	15388891, 2832442	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2856249, 28830391		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1373742, 3495006	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	1698479, 2832442, 3264194, 3495006	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	30026572	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	2142747, 2465043, 27581357, 2832442, 30425048, 3259234, 3495006, 8876234, 8907269, 9116300		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	23602969		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	27749956		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	18328744		★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	21854753		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31824413		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28572167, 30902885, 31655310, 31838741		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26762581		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31732480	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	25313137		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29323162, 7506922	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	19926892		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25012167, 28325905, 33549023	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34239365	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	19926892		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19926892, 25652333, 28072466		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	19926892		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25012167	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25012167	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	19926892		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20593409, 24263966	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	7833270		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	10227720		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25162674		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	2787682		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12465600, 1334964, 14709771, 15205327, 15289345, 15679045, 16618760, 16927019, 17172715, 19188147, 19949854, 20876703, 22096574, 22678116, 24013225, 24769444, 24956020, 27599777, 28463564, 29796177, 30342176, 31217507, 8981366		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16618760		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30816518, 9815987		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24468794, 27107415, 8543387		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	1500387, 18708368, 18823650, 22005523, 22909061, 22988839, 2973787, 7965406, 8698627		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28039167, 29324844		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29767252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23372702		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20593409, 21822305, 22434539, 22678116, 22988839, 23233531, 24468794, 25241894, 28469954, 28478671, 29218239, 29293000, 29767252, 30188867, 30342176, 31438996, 31552020, 31565097, 8698627, 9815777		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17332318		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12235002		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16618760		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12465600, 12748184, 22678116		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16618760		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16618760		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	BEFREE	1829808		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	30940906		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16278308	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29643229, 3498641		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28697890		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	24722292		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24722292	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	2787682, 32581053	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29643229		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	10657672		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	2142747, 7858491		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11122147	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	1533785		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	2669997	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17922812	Associate	★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	30349538		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	26743272, 37479694	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25886010	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10066091, 10227720, 12235002, 12465600, 12480707, 12748184, 1334964, 14709771, 1535551, 16407111, 16618760, 16820947, 17283136, 17332318, 19188147, 19197940, 19711348, 19951991, 20191615, 21063905, 21239715, 21822305, 21854753, 22276166, 22988839, 24013225, 24263966, 24590894, 24604026, 24737547, 24769444, 25313137, 25418473, 27245147, 27599777, 28459367, 28655795, 28779164, 29136508, 29174801, 29499713, 29875321, 30206409, 30237497, 30322928, 30504718, 30580386, 30859335, 31107544, 31138333, 31277684, 31545245, 31565097, 31655310, 8543387, 8981366, 9116300, 9815777, 9815987		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	Pubtator	37093310	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19711348		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental disorder	Pubtator	17192722	Associate	★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	28256556		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	26865613		★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	18328744		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23870818		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21895511	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Cicatricial Pemphigoid	Ocular Cicatricial Pemphigoid	BEFREE	12202518		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	BEFREE	20436471, 20839008, 21623375, 21959292		★☆☆☆☆ Found in Text Mining only
Osteitis Deformans	Paget disease	CTD_human_DG	20436471		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25854167	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29547667, 40165259	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	36529415	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	40211184	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous dysplasia	Pubtator	21983933	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	20796300	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	22105655, 28816930, 29152381		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	LHGDN	11792569		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	11956177, 12074592, 12865350, 23776468, 29501441, 7510095, 8630510, 9311741		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	Pubtator	9311741	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	15176972, 21895511	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	16973889, 23028809		★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	28816930		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	2973787		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18708368, 18823650, 22005523, 22909061, 22988839, 7965406, 8698627		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1695482, 18708368, 2663797, 36757936, 7599064, 8605095	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22909061	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	3488774		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17243911		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	10926834	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23372702		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	24593806, 37834363	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31554150		★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	1606715		★☆☆☆☆ Found in Text Mining only
Peeling Skin Syndrome	Peeling skin syndrome	Pubtator	26970370	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28474967		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	LHGDN	18435789		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	24592910, 28474967, 28779164, 31682007		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	25543187		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	2465043		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28039167, 29324844		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18510570		★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	16275889		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36846109	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16275889		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	17431224		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	3495006		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29734839		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	31565097	Associate	★☆☆☆☆ Found in Text Mining only
Rhegmatogenous Retinal Detachment Autosomal Dominant	Rhegmatogenous retinal detachment	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15485996, 15593184, 17527089, 25652333, 31484730, 3263464		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16859503, 18668547		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	26443621		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	2171188		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	39345889	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	22700848, 27821504		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	25854167		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10360828		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	19188147		★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, HEREDITARY, 2	Spherocytosis	BEFREE	8391471		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15001836, 15640942, 18676750		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31671219		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23870818		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29767252		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26945355, 29358859	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	17527089		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22700848, 27821504, 29562615		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	16407111, 17527089, 30237497, 30594158, 31229240		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	24342436	Associate	★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	10072108	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	16203990	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23372702		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23372702		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	9067911	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	17332318		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32356483	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	10072108	Stimulate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	28407719	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	32542038	Associate	★☆☆☆☆ Found in Text Mining only
Wiskott-Aldrich Syndrome	Wiskott-Aldrich Syndrome	BEFREE	11950596		★☆☆☆☆ Found in Text Mining only