Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	143425
Gene name	Synaptotagmin 9
Gene symbol	SYT9
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11p15.4

100

Show/Hide all (100)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026062	hsa-miR-196a-5p	Sequencing	20371350
MIRT571234	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT571233	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT571232	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT571231	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT571230	hsa-miR-1253	PAR-CLIP	20371350
MIRT571229	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT571228	hsa-miR-3171	PAR-CLIP	20371350
MIRT571227	hsa-miR-567	PAR-CLIP	20371350
MIRT571225	hsa-miR-4711-3p	PAR-CLIP	20371350
MIRT571226	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT571224	hsa-miR-573	PAR-CLIP	20371350
MIRT571223	hsa-miR-297	PAR-CLIP	20371350
MIRT571234	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT571233	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT571232	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT571231	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT571230	hsa-miR-1253	PAR-CLIP	20371350
MIRT571229	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT571228	hsa-miR-3171	PAR-CLIP	20371350
MIRT571227	hsa-miR-567	PAR-CLIP	20371350
MIRT571225	hsa-miR-4711-3p	PAR-CLIP	20371350
MIRT571226	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT571224	hsa-miR-573	PAR-CLIP	20371350
MIRT571223	hsa-miR-297	PAR-CLIP	20371350
MIRT450067	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT450065	hsa-miR-3919	PAR-CLIP	22100165
MIRT450066	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT450064	hsa-miR-3928-5p	PAR-CLIP	22100165
MIRT450063	hsa-miR-6806-3p	PAR-CLIP	22100165
MIRT450062	hsa-miR-127-5p	PAR-CLIP	22100165
MIRT571234	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT571233	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT571232	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT571231	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT571230	hsa-miR-1253	PAR-CLIP	20371350
MIRT571229	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT571228	hsa-miR-3171	PAR-CLIP	20371350
MIRT571227	hsa-miR-567	PAR-CLIP	20371350
MIRT571225	hsa-miR-4711-3p	PAR-CLIP	20371350
MIRT571226	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT571224	hsa-miR-573	PAR-CLIP	20371350
MIRT571223	hsa-miR-297	PAR-CLIP	20371350
MIRT571234	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT571233	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT571232	hsa-miR-1252-5p	PAR-CLIP	20371350
MIRT571231	hsa-miR-4795-5p	PAR-CLIP	20371350
MIRT571230	hsa-miR-1253	PAR-CLIP	20371350
MIRT571229	hsa-miR-6770-5p	PAR-CLIP	20371350
MIRT571228	hsa-miR-3171	PAR-CLIP	20371350
MIRT571227	hsa-miR-567	PAR-CLIP	20371350
MIRT571225	hsa-miR-4711-3p	PAR-CLIP	20371350
MIRT571226	hsa-miR-3616-5p	PAR-CLIP	20371350
MIRT571224	hsa-miR-573	PAR-CLIP	20371350
MIRT571223	hsa-miR-297	PAR-CLIP	20371350
MIRT450067	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT450065	hsa-miR-3919	PAR-CLIP	22100165
MIRT450066	hsa-miR-4756-3p	PAR-CLIP	22100165
MIRT450064	hsa-miR-3928-5p	PAR-CLIP	22100165
MIRT450063	hsa-miR-6806-3p	PAR-CLIP	22100165
MIRT450062	hsa-miR-127-5p	PAR-CLIP	22100165
MIRT1407780	hsa-miR-1229	CLIP-seq
MIRT1407781	hsa-miR-1257	CLIP-seq
MIRT1407782	hsa-miR-136	CLIP-seq
MIRT1407783	hsa-miR-141	CLIP-seq
MIRT1407784	hsa-miR-196a	CLIP-seq
MIRT1407785	hsa-miR-196b	CLIP-seq
MIRT1407786	hsa-miR-200a	CLIP-seq
MIRT1407787	hsa-miR-2052	CLIP-seq
MIRT1407788	hsa-miR-219-2-3p	CLIP-seq
MIRT1407789	hsa-miR-2964a-3p	CLIP-seq
MIRT1407790	hsa-miR-3117-5p	CLIP-seq
MIRT1407791	hsa-miR-324-5p	CLIP-seq
MIRT1407792	hsa-miR-3607-5p	CLIP-seq
MIRT1407793	hsa-miR-3622b-5p	CLIP-seq
MIRT1407794	hsa-miR-380	CLIP-seq
MIRT1407795	hsa-miR-3977	CLIP-seq
MIRT1407796	hsa-miR-425	CLIP-seq
MIRT1407797	hsa-miR-4642	CLIP-seq
MIRT1407798	hsa-miR-4676-5p	CLIP-seq
MIRT1407799	hsa-miR-4695-3p	CLIP-seq
MIRT1407800	hsa-miR-4712-3p	CLIP-seq
MIRT1407801	hsa-miR-4774-5p	CLIP-seq
MIRT1407802	hsa-miR-4799-5p	CLIP-seq
MIRT1407803	hsa-miR-548m	CLIP-seq
MIRT1407804	hsa-miR-575	CLIP-seq
MIRT1407805	hsa-miR-659	CLIP-seq
MIRT1554386	hsa-miR-676	CLIP-seq
MIRT2122248	hsa-miR-1972	CLIP-seq
MIRT2122249	hsa-miR-2467-3p	CLIP-seq
MIRT2122250	hsa-miR-3619-3p	CLIP-seq
MIRT2122251	hsa-miR-4468	CLIP-seq
MIRT2122252	hsa-miR-4650-5p	CLIP-seq
MIRT2122253	hsa-miR-4782-5p	CLIP-seq
MIRT2637896	hsa-miR-1252	CLIP-seq
MIRT2637897	hsa-miR-3647-5p	CLIP-seq
MIRT2637898	hsa-miR-4496	CLIP-seq
MIRT2637896	hsa-miR-1252	CLIP-seq
MIRT2637897	hsa-miR-3647-5p	CLIP-seq
MIRT2637898	hsa-miR-4496	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0000149	Function	SNARE binding	IEA
GO:0001786	Function	Phosphatidylserine binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031045	Component	Dense core granule	IBA
GO:0031045	Component	Dense core granule	IEA
GO:0031340	Process	Positive regulation of vesicle fusion	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0061891	Function	Calcium ion sensor activity	IBA
GO:0070382	Component	Exocytic vesicle	IBA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0099502	Process	Calcium-dependent activation of synaptic vesicle fusion	IEA

MIM	HGNC	e!Ensembl
613528	19265	ENSG00000170743

Q86SS6

Protein name

Synaptotagmin-9 (Synaptotagmin IX) (SytIX)

Protein function

May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	235 → 333	C2 domain	Domain
PF00168	C2	367 → 476	C2 domain	Domain

Sequence

MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVT
ACGLALFGVSLFVSWKLCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPT
PCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPD
FNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVK
IHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEA
RKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNDNVDLGELMFSL
CYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYN
EAIVFDVPPENIDQIHLSIAVMDYDRVGHNEIIGVCQVGNEAERLGRDHWSEMLSYPRKP
IAHWHSLVEKR

Sequence length

491

Interactions

View interactions

	Reactome
			Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHAGAS CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25960086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	26972010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	26972010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome, Type II	Cockayne Syndrome	BEFREE	26972010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	BEFREE	28834160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Congenital heart septal defect	Pubtator	28834160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23334854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23334854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23334854	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34229539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SYT9 (synaptotagmin 9)