CSE1L (chromosome segregation 1 like)

Gene

• Entrez ID: 1434
• Gene name: Chromosome segregation 1 like
• Gene symbol: CSE1L
• Synonyms (NCBI Gene): CAS, CSE1, XPO2
• Chromosome: 20
• Chromosome location: 20q13.13
• Summary: Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007252	hsa-miR-137	Luciferase reporter assay, Western blot	23252729
MIRT020837	hsa-miR-155-5p	Proteomics	18668040
MIRT047399	hsa-miR-34a-5p	CLASH	23622248
MIRT044669	hsa-miR-320a	CLASH	23622248
MIRT038321	hsa-miR-130b-5p	CLASH	23622248
MIRT675621	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT659339	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT659338	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT675620	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT659337	hsa-miR-938	HITS-CLIP	23824327
MIRT659341	hsa-miR-3646	HITS-CLIP	23824327
MIRT659340	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT659339	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT659338	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT659337	hsa-miR-938	HITS-CLIP	23824327
MIRT626800	hsa-miR-4709-5p	HITS-CLIP	23824327
MIRT626799	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT626798	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT626797	hsa-miR-4252	HITS-CLIP	23824327
MIRT626796	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT626795	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT626794	hsa-miR-421	HITS-CLIP	23824327
MIRT626793	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT626792	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT626791	hsa-miR-7703	HITS-CLIP	23824327
MIRT538365	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT538364	hsa-miR-548ab	PAR-CLIP	21572407
MIRT538363	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT538362	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT538361	hsa-miR-548ak	PAR-CLIP	21572407
MIRT538360	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT538359	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT538358	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT538357	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT538356	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT538355	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT538354	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT538353	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT538352	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT538351	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT538350	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT538349	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT538347	hsa-miR-548i	PAR-CLIP	21572407
MIRT538348	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT538346	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT538345	hsa-miR-548w	PAR-CLIP	21572407
MIRT538344	hsa-miR-548y	PAR-CLIP	21572407
MIRT538343	hsa-miR-559	PAR-CLIP	21572407
MIRT538342	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT538341	hsa-miR-548k	PAR-CLIP	21572407
MIRT538340	hsa-miR-8054	PAR-CLIP	21572407
MIRT538339	hsa-miR-548l	PAR-CLIP	21572407
MIRT538338	hsa-miR-5692a	PAR-CLIP	21572407
MIRT538337	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT538336	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT545461	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT545460	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT545459	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT545458	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT545457	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT545456	hsa-miR-371a-5p	PAR-CLIP	21572407
MIRT545455	hsa-miR-372-5p	PAR-CLIP	21572407
MIRT545454	hsa-miR-3671	PAR-CLIP	21572407
MIRT538365	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT538364	hsa-miR-548ab	PAR-CLIP	22012620
MIRT538363	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT538362	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT538361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT538360	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT538359	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT538358	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT538357	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT538356	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT538355	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT538354	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT538353	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT538352	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT538351	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT538350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT538349	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT538347	hsa-miR-548i	PAR-CLIP	22012620
MIRT538348	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT538346	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT538345	hsa-miR-548w	PAR-CLIP	22012620
MIRT538344	hsa-miR-548y	PAR-CLIP	22012620
MIRT538343	hsa-miR-559	PAR-CLIP	22012620
MIRT538342	hsa-miR-548av-5p	PAR-CLIP	22012620
MIRT538341	hsa-miR-548k	PAR-CLIP	22012620
MIRT538340	hsa-miR-8054	PAR-CLIP	22012620
MIRT538339	hsa-miR-548l	PAR-CLIP	22012620
MIRT538338	hsa-miR-5692a	PAR-CLIP	22012620
MIRT538337	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT538336	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT675620	hsa-miR-3065-5p	HITS-CLIP	27418678
MIRT675620	hsa-miR-3065-5p	HITS-CLIP	27418678
MIRT675621	hsa-miR-3529-3p	HITS-CLIP	27418678
MIRT675621	hsa-miR-3529-3p	HITS-CLIP	27418678
MIRT675621	hsa-miR-3529-3p	HITS-CLIP	27418678
MIRT675621	hsa-miR-3529-3p	HITS-CLIP	23824327
MIRT659339	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT659338	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT675620	hsa-miR-3065-5p	HITS-CLIP	23824327
MIRT659337	hsa-miR-938	HITS-CLIP	23824327
MIRT659341	hsa-miR-3646	HITS-CLIP	23824327
MIRT659340	hsa-miR-1252-3p	HITS-CLIP	23824327
MIRT659339	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT659338	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT659337	hsa-miR-938	HITS-CLIP	23824327
MIRT626800	hsa-miR-4709-5p	HITS-CLIP	23824327
MIRT626799	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT626798	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT626797	hsa-miR-4252	HITS-CLIP	23824327
MIRT626796	hsa-miR-505-3p	HITS-CLIP	23824327
MIRT626795	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT626794	hsa-miR-421	HITS-CLIP	23824327
MIRT626793	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT626792	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT626791	hsa-miR-7703	HITS-CLIP	23824327
MIRT538365	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT538364	hsa-miR-548ab	PAR-CLIP	21572407
MIRT538363	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT538362	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT538361	hsa-miR-548ak	PAR-CLIP	21572407
MIRT538360	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT538359	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT538358	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT538357	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT538356	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT538355	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT538354	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT538353	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT538352	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT538351	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT538350	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT538349	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT538347	hsa-miR-548i	PAR-CLIP	21572407
MIRT538348	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT538346	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT538345	hsa-miR-548w	PAR-CLIP	21572407
MIRT538344	hsa-miR-548y	PAR-CLIP	21572407
MIRT538343	hsa-miR-559	PAR-CLIP	21572407
MIRT538342	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT538341	hsa-miR-548k	PAR-CLIP	21572407
MIRT538340	hsa-miR-8054	PAR-CLIP	21572407
MIRT538339	hsa-miR-548l	PAR-CLIP	21572407
MIRT538338	hsa-miR-5692a	PAR-CLIP	21572407
MIRT538337	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT538336	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT545461	hsa-miR-340-3p	PAR-CLIP	21572407
MIRT545460	hsa-miR-6827-3p	PAR-CLIP	21572407
MIRT545459	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT545458	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT545457	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT545456	hsa-miR-371a-5p	PAR-CLIP	21572407
MIRT545455	hsa-miR-372-5p	PAR-CLIP	21572407
MIRT545454	hsa-miR-3671	PAR-CLIP	21572407
MIRT538365	hsa-miR-548a-5p	PAR-CLIP	22012620
MIRT538364	hsa-miR-548ab	PAR-CLIP	22012620
MIRT538363	hsa-miR-548ad-5p	PAR-CLIP	22012620
MIRT538362	hsa-miR-548ae-5p	PAR-CLIP	22012620
MIRT538361	hsa-miR-548ak	PAR-CLIP	22012620
MIRT538360	hsa-miR-548am-5p	PAR-CLIP	22012620
MIRT538359	hsa-miR-548ap-5p	PAR-CLIP	22012620
MIRT538358	hsa-miR-548aq-5p	PAR-CLIP	22012620
MIRT538357	hsa-miR-548ar-5p	PAR-CLIP	22012620
MIRT538356	hsa-miR-548as-5p	PAR-CLIP	22012620
MIRT538355	hsa-miR-548au-5p	PAR-CLIP	22012620
MIRT538354	hsa-miR-548ay-5p	PAR-CLIP	22012620
MIRT538353	hsa-miR-548b-5p	PAR-CLIP	22012620
MIRT538352	hsa-miR-548bb-5p	PAR-CLIP	22012620
MIRT538351	hsa-miR-548c-5p	PAR-CLIP	22012620
MIRT538350	hsa-miR-548d-5p	PAR-CLIP	22012620
MIRT538349	hsa-miR-548h-5p	PAR-CLIP	22012620
MIRT538347	hsa-miR-548i	PAR-CLIP	22012620
MIRT538348	hsa-miR-548j-5p	PAR-CLIP	22012620
MIRT538346	hsa-miR-548o-5p	PAR-CLIP	22012620
MIRT538345	hsa-miR-548w	PAR-CLIP	22012620
MIRT538344	hsa-miR-548y	PAR-CLIP	22012620
MIRT538343	hsa-miR-559	PAR-CLIP	22012620
MIRT538342	hsa-miR-548av-5p	PAR-CLIP	22012620
MIRT538341	hsa-miR-548k	PAR-CLIP	22012620
MIRT538340	hsa-miR-8054	PAR-CLIP	22012620
MIRT538339	hsa-miR-548l	PAR-CLIP	22012620
MIRT538338	hsa-miR-5692a	PAR-CLIP	22012620
MIRT538337	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT538336	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT911627	hsa-miR-1178	CLIP-seq
MIRT911628	hsa-miR-1537	CLIP-seq
MIRT911629	hsa-miR-1973	CLIP-seq
MIRT911630	hsa-miR-19a	CLIP-seq
MIRT911631	hsa-miR-19b	CLIP-seq
MIRT911632	hsa-miR-203	CLIP-seq
MIRT911633	hsa-miR-340	CLIP-seq
MIRT911634	hsa-miR-3613-3p	CLIP-seq
MIRT911635	hsa-miR-362-5p	CLIP-seq
MIRT911636	hsa-miR-3658	CLIP-seq
MIRT911637	hsa-miR-3685	CLIP-seq
MIRT911638	hsa-miR-384	CLIP-seq
MIRT911639	hsa-miR-3920	CLIP-seq
MIRT911640	hsa-miR-4282	CLIP-seq
MIRT911641	hsa-miR-4422	CLIP-seq
MIRT911642	hsa-miR-4426	CLIP-seq
MIRT911643	hsa-miR-4496	CLIP-seq
MIRT911644	hsa-miR-4504	CLIP-seq
MIRT911645	hsa-miR-4647	CLIP-seq
MIRT911646	hsa-miR-4662b	CLIP-seq
MIRT911647	hsa-miR-4679	CLIP-seq
MIRT911648	hsa-miR-4698	CLIP-seq
MIRT911649	hsa-miR-4735-5p	CLIP-seq
MIRT911650	hsa-miR-4738-3p	CLIP-seq
MIRT911651	hsa-miR-4761-5p	CLIP-seq
MIRT911652	hsa-miR-500b	CLIP-seq
MIRT911653	hsa-miR-501-5p	CLIP-seq
MIRT911654	hsa-miR-539	CLIP-seq
MIRT911655	hsa-miR-574-3p	CLIP-seq
MIRT911656	hsa-miR-628-5p	CLIP-seq
MIRT911657	hsa-miR-629	CLIP-seq
MIRT911658	hsa-miR-889	CLIP-seq
MIRT911627	hsa-miR-1178	CLIP-seq
MIRT1970276	hsa-miR-23a	CLIP-seq
MIRT1970277	hsa-miR-23b	CLIP-seq
MIRT1970278	hsa-miR-23c	CLIP-seq
MIRT1970279	hsa-miR-3129-3p	CLIP-seq
MIRT1970280	hsa-miR-323b-3p	CLIP-seq
MIRT911633	hsa-miR-340	CLIP-seq
MIRT911634	hsa-miR-3613-3p	CLIP-seq
MIRT1970281	hsa-miR-377	CLIP-seq
MIRT911649	hsa-miR-4735-5p	CLIP-seq
MIRT911651	hsa-miR-4761-5p	CLIP-seq
MIRT911627	hsa-miR-1178	CLIP-seq
MIRT2206189	hsa-miR-128	CLIP-seq
MIRT2206190	hsa-miR-1301	CLIP-seq
MIRT2206191	hsa-miR-1323	CLIP-seq
MIRT2206192	hsa-miR-146a	CLIP-seq
MIRT2206193	hsa-miR-146b-5p	CLIP-seq
MIRT911628	hsa-miR-1537	CLIP-seq
MIRT2206194	hsa-miR-155	CLIP-seq
MIRT2206195	hsa-miR-194	CLIP-seq
MIRT911629	hsa-miR-1973	CLIP-seq
MIRT911630	hsa-miR-19a	CLIP-seq
MIRT911631	hsa-miR-19b	CLIP-seq
MIRT1970276	hsa-miR-23a	CLIP-seq
MIRT1970277	hsa-miR-23b	CLIP-seq
MIRT1970278	hsa-miR-23c	CLIP-seq
MIRT2206196	hsa-miR-3121-5p	CLIP-seq
MIRT1970279	hsa-miR-3129-3p	CLIP-seq
MIRT911633	hsa-miR-340	CLIP-seq
MIRT911634	hsa-miR-3613-3p	CLIP-seq
MIRT2206197	hsa-miR-3616-5p	CLIP-seq
MIRT911635	hsa-miR-362-5p	CLIP-seq
MIRT2206198	hsa-miR-3647-5p	CLIP-seq
MIRT911637	hsa-miR-3685	CLIP-seq
MIRT1970281	hsa-miR-377	CLIP-seq
MIRT911638	hsa-miR-384	CLIP-seq
MIRT911640	hsa-miR-4282	CLIP-seq
MIRT911641	hsa-miR-4422	CLIP-seq
MIRT911643	hsa-miR-4496	CLIP-seq
MIRT2206199	hsa-miR-4539	CLIP-seq
MIRT2206200	hsa-miR-4635	CLIP-seq
MIRT2206201	hsa-miR-4660	CLIP-seq
MIRT2206202	hsa-miR-4669	CLIP-seq
MIRT2206203	hsa-miR-4670-3p	CLIP-seq
MIRT911647	hsa-miR-4679	CLIP-seq
MIRT2206204	hsa-miR-4684-3p	CLIP-seq
MIRT911648	hsa-miR-4698	CLIP-seq
MIRT2206205	hsa-miR-4724-5p	CLIP-seq
MIRT911649	hsa-miR-4735-5p	CLIP-seq
MIRT911651	hsa-miR-4761-5p	CLIP-seq
MIRT2206206	hsa-miR-4786-3p	CLIP-seq
MIRT911652	hsa-miR-500b	CLIP-seq
MIRT911653	hsa-miR-501-5p	CLIP-seq
MIRT2206207	hsa-miR-5047	CLIP-seq
MIRT2206208	hsa-miR-518a-5p	CLIP-seq
MIRT2206209	hsa-miR-527	CLIP-seq
MIRT911654	hsa-miR-539	CLIP-seq
MIRT2206210	hsa-miR-548o	CLIP-seq
MIRT2206211	hsa-miR-573	CLIP-seq
MIRT911655	hsa-miR-574-3p	CLIP-seq
MIRT2206212	hsa-miR-802	CLIP-seq
MIRT911658	hsa-miR-889	CLIP-seq
MIRT2206190	hsa-miR-1301	CLIP-seq
MIRT2206194	hsa-miR-155	CLIP-seq
MIRT2206201	hsa-miR-4660	CLIP-seq
MIRT2206207	hsa-miR-5047	CLIP-seq
MIRT2206190	hsa-miR-1301	CLIP-seq
MIRT2206192	hsa-miR-146a	CLIP-seq
MIRT2206193	hsa-miR-146b-5p	CLIP-seq
MIRT2206194	hsa-miR-155	CLIP-seq
MIRT2206196	hsa-miR-3121-5p	CLIP-seq
MIRT911637	hsa-miR-3685	CLIP-seq
MIRT911638	hsa-miR-384	CLIP-seq
MIRT2509432	hsa-miR-4428	CLIP-seq
MIRT911643	hsa-miR-4496	CLIP-seq
MIRT2206201	hsa-miR-4660	CLIP-seq
MIRT911647	hsa-miR-4679	CLIP-seq
MIRT2206207	hsa-miR-5047	CLIP-seq
MIRT2206190	hsa-miR-1301	CLIP-seq
MIRT2206192	hsa-miR-146a	CLIP-seq
MIRT2206193	hsa-miR-146b-5p	CLIP-seq
MIRT2206194	hsa-miR-155	CLIP-seq
MIRT2206196	hsa-miR-3121-5p	CLIP-seq
MIRT911637	hsa-miR-3685	CLIP-seq
MIRT911638	hsa-miR-384	CLIP-seq
MIRT2509432	hsa-miR-4428	CLIP-seq
MIRT911643	hsa-miR-4496	CLIP-seq
MIRT2206201	hsa-miR-4660	CLIP-seq
MIRT911647	hsa-miR-4679	CLIP-seq
MIRT2206207	hsa-miR-5047	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005049	Function	Nuclear export signal receptor activity	IBA
GO:0005049	Function	Nuclear export signal receptor activity	TAS	9323134
GO:0005515	Function	Protein binding	IPI	17719542, 21209336, 30833792
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9323134
GO:0005635	Component	Nuclear envelope	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9323134
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006606	Process	Protein import into nucleus	IBA
GO:0006611	Process	Protein export from nucleus	IBA
GO:0006886	Process	Intracellular protein transport	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0031267	Function	Small GTPase binding	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337

Other IDs

• MIM: 601342
• HGNC: 2431
• e!Ensembl: ENSG00000124207

Protein

• UniProt ID: P55060
• Protein name: Exportin-2 (Exp2) (Cellular apoptosis susceptibility protein) (Chromosome segregation 1-like protein) (Importin-alpha re-exporter)
• Protein function: Export receptor for importin-alpha. Mediates importin-alpha re-export from the nucleus to the cytoplasm after import substrates (cargos) have been released into the nucleoplasm. In the nucleus binds cooperatively to importin-alpha and to the GTP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03810	IBN_N	29 → 102	Importin-beta N-terminal domain	Family
  PF08506	Cse1	156 → 526	Cse1	Family
  PF03378	CAS_CSE1	527 → 962	CAS/CSE protein, C-terminus	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain, placenta, ovary, testis and trachea (at protein level) (PubMed:10331944). Widely expressed (PubMed:10331944). Highly expressed in testis and in proliferating cells (PubMed:10331944, PubMed:7479798). {ECO:0000269|PubM
• Sequence:

  MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPLLLLTLLEKSQDNVIKV
  CASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR
  EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAF
  ALPLTNLFKATIELCSTHANDASALRILFSSLILISKLFYSLNFQDLPEFFEDNMETWMN
  NFHTLLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFVTAIWNL
  LVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSICEKVIVPNMEFRAADEE
  AFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLCKFFEGPVTGIFSGYVNSMLQEYAKNP
  SVNWKHKDAAIYLVTSLASKAQTQKHGITQANELVNLTEFFVNHILPDLKSANVNEFPVL
  KADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATL
  FTAAEIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTLITQLTQ
  KLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEALFLVFTEILQNDVQEFI
  PYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVLWERTGNIPALVRLLQAFLERGSNTIA
  SAAADKIPGLLGVFQKLIASKANDHQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQN
  SKTTKFIKSFLVFINLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKK
  ICAVGITKLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIEDTPGYQ
  TAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQ
  GYLQAASVTLL

• Sequence length: 971

Pathways

KEGG:

Nucleocytoplasmic transport
Salmonella infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	15598753		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27941559		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	18059182		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	27521996, 9854589		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22711543		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	23252729		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27521996	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis	Amyloidosis	BEFREE	28570763		★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	15354419, 22909774, 27155185, 30266356, 31221009, 31221010		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11181651	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30542083		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30541503		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	27941559		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27941559	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	1723634		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11724300, 18256281, 24457433, 31140031		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26668314, 35403306, 8963895	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	22967991		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22967991	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11351043, 27521996	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	1360498, 22711543, 8250909		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31371628, 33602168, 38410971	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	9056741		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23948303		★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	30186852		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	28474136, 30355202, 31025147, 31201981		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28887238, 29524497, 30341824, 30355202, 30418006, 30922980		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	23252729		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30341970		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	31299468		★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	BEFREE	30987467, 31221009		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23621178, 31140031		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18059182, 7651399	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22450763, 22711543, 23806821, 27121919, 27521996, 30144787		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22711543, 23621178, 27121919, 36319976, 37749132, 8963895	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	23806821		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27521996	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28628499		★☆☆☆☆ Found in Text Mining only
Coronary Artery Vasospasm	Coronary Artery Vasospasm	BEFREE	28766048		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	28766048		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28628499		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28224925		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28224925, 30048166		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22967991		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31221009, 31221010		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	9142183		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	BEFREE	31221010		★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	BEFREE	31129760		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	11603220, 28790116		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29630856		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	29630856	Inhibit	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	30542083		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	23536552		★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	BEFREE	31345156		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	20472655		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	31140031		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11351043, 34022224	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23252729		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23252729		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28628499		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28602666		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	9006318	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28602666		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	9606285		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	37892144	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	31383592		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	8963895		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	8963895	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16786158		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24799195, 31470077		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	11295109		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34022224	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31383592	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	9006318	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27622933		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	11724300, 18256281, 24457433, 31140031		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28790116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24799195		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9056741		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23948303		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31347172		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	1723634, 18059182, 20688056, 22389439, 23806821, 29697367, 31140031, 8158775		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23621178, 31140031		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31308057		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	10368674, 8213640		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28628499		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	20470445		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	27622933		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	32495878	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	16077901		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11603220, 12472286, 20470445, 2047381, 22450763, 23252729, 23806821, 24799195, 26892809, 28790116, 30485574, 9472046		★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	10368674, 8213640		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30770289		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	23252729		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28889222		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29714810		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28387323		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28387323	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23948303		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35013112	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36332889	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	9854589		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	1733409		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	12472286		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11181651		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	32398722	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	30485574, 31140031		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	30485574	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31823148		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	31129760		★☆☆☆☆ Found in Text Mining only
Speech Delay	Speech Delay	BEFREE	31221009		★☆☆☆☆ Found in Text Mining only
Speech Disorders	Speech Disorders	BEFREE	31221009		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35634436	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28438299		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31347172		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	31140031		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29336220, 30048166, 30593716		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26892809		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35403306	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	GWASCAT_DG	27622933		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22653741	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	23252729		★☆☆☆☆ Found in Text Mining only