Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	143
Gene name	Poly(ADP-ribose) polymerase family member 4
Gene symbol	PARP4
Synonyms (NCBI Gene)	ADPRTL1ARTD4PARP-4PARPLPH5PVAULT3VPARPVWA5Cp193
Chromosome	13
Chromosome location	13q12.12
Summary	This gene encodes poly(ADP-ribosyl)transferase-like 1 protein, which is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA

Show/Hide all (15)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028753	hsa-miR-26b-5p	Microarray	19088304
MIRT037188	hsa-miR-877-3p	CLASH	23622248
MIRT052749	hsa-miR-1260b	CLASH	23622248
MIRT440037	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440037	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT733037	hsa-miR-125a-5p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)In situ hybridizationLuciferase reporter assayRNA-seqqRT-PCRWestern blotting	33520365
MIRT1214588	hsa-miR-4282	CLIP-seq
MIRT1214589	hsa-miR-4328	CLIP-seq
MIRT1214590	hsa-miR-561	CLIP-seq
MIRT2431895	hsa-miR-4528	CLIP-seq
MIRT2431895	hsa-miR-4528	CLIP-seq
MIRT2588278	hsa-miR-4670-3p	CLIP-seq
MIRT2588279	hsa-miR-579	CLIP-seq
MIRT2431895	hsa-miR-4528	CLIP-seq
MIRT2588278	hsa-miR-4670-3p	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	TAS	10100603
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IBA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IDA	10477748
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	IEA
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	NAS	10644454
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	10100603
GO:0005515	Function	Protein binding	IPI	15169895, 22190034
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10644454
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10477748
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005876	Component	Spindle microtubule	IDA	10477748
GO:0006281	Process	DNA repair	NAS	12101391
GO:0006281	Process	DNA repair	TAS	10100603
GO:0006954	Process	Inflammatory response	IMP	12123754
GO:0006974	Process	DNA damage response	NAS	10477748
GO:0009410	Process	Response to xenobiotic stimulus	NAS	11291045
GO:0016020	Component	Membrane	HDA	19946888
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0016779	Function	Nucleotidyltransferase activity	IEA
GO:0019899	Function	Enzyme binding	IDA	15169895
GO:0036211	Process	Protein modification process	IDA	10477748
GO:0036211	Process	Protein modification process	TAS	10100603
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0140806	Function	NAD+-protein-aspartate ADP-ribosyltransferase activity	IEA
GO:0140807	Function	NAD+-protein-glutamate ADP-ribosyltransferase activity	IEA
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	IDA	25043379
GO:1990904	Component	Ribonucleoprotein complex	IEA
GO:1990904	Component	Ribonucleoprotein complex	NAS	11479319

MIM	HGNC	e!Ensembl
607519	271	ENSG00000102699

Q9UKK3

Protein name

Protein mono-ADP-ribosyltransferase PARP4 (EC 2.4.2.-) (193 kDa vault protein) (ADP-ribosyltransferase diphtheria toxin-like 4) (ARTD4) (PARP-related/IalphaI-related H5/proline-rich) (PH5P) (Poly [ADP-ribose] polymerase 4) (PARP-4) (Vault poly(ADP-ribose)

Protein function

Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins.

PDB

8SWY , 8SWZ , 8SX1 , 8SX2 , 9BW6 , 9BW7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00533	BRCT	1 → 81	BRCA1 C Terminus (BRCT) domain	Family
PF00644	PARP	389 → 566	Poly(ADP-ribose) polymerase catalytic domain	Family
PF08487	VIT	623 → 733	Vault protein inter-alpha-trypsin domain	Family
PF00092	VWA	876 → 1042	von Willebrand factor type A domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed; the highest levels are in the kidney; also detected in heart, placenta, lung, liver, skeletal muscle, spleen, leukocytes and pancreas. {ECO:0000269|PubMed:10477748}.

Sequence

MVMGIFANCIFCLKVKYLPQQQKKKLQTDIKENGGKFSFSLNPQCTHIILDNADVLSQYQ
LNSIQKNHVHIANPDFIWKSIREKRLLDVKNYDPYKPLDITPPPDQKASSSEVKTEGLCP
DSATEEEDTVELTEFGMQNVEIPHLPQDFEVAKYNTLEKVGMEGGQEAVVVELQCSRDSR
DCPFLISSHFLLDDGMETRRQFAIKKTSEDASEYFENYIEELKKQGFLLREHFTPEATQL
ASEQLQALLLEEVMNSSTLSQEVSDLVEMIWAEALGHLEHMLLKPVNRISLNDVSKAEGI
LLLVKAALKNGETAEQLQKMMTEFYRLIPHKGTMPKEVNLGLLAKKADLCQLIRDMVNVC
ETNLSKPNPPSLAKYRALRCKIEHVEQNTEEFLRVRKEVLQNHHSKSPVDVLQIFRVGRV
NETTEFLSKLGNVRPLLHGSPVQNIVGILCRGLLLPKVVEDRGVQRTDVGNLGSGIYFSD
SLSTSIKYSHPGETDGTRLLLICDVALGKCMDLHEKDFSLTEAPPGYDSVHGVSQTASVT
TDFEDDEFVVYKTNQVKMKYIIKFSMPGDQIKDFHPSDHTELEEYRPEFSNFSKVEDYQL
PDAKTSSSTKAGLQDASGNLVPLEDVHIKGRIIDTVAQVIVFQTYTNKSHVPIEAKYIFP
LDDKAAVCGFEAFINGKHIVGEIKEKEEAQQEYLEAVTQGHGAYLMSQDAPDVFTVSVGN
LPPKAKVLIKITYITELSILGTVGVFFMPATVAPWQQDKALNENLQDTVEKICIKEIGTK
QSFSLTMSIEMPYVIEFIFSDTHELKQKRTDCKAVISTMEGSSLDSSGFSLHIGLSAAYL
PRMWVEKHPEKESEACMLVFQPDLDVDLPDLASESEVIICLDCSSSMEGVTFLQAKQIAL
HALSLVGEKQKVNIIQFGTGYKELFSYPKHITSNTMAAEFIMSATPTMGNTDFWKTLRYL
SLLYPARGSRNILLVSDGHLQDESLTLQLVKRSRPHTRLFACGIGSTANRHVLRILSQCG
AGVFEYFNAKSKHSWRKQIEDQMTRLCSPSCHSVSVKWQQLNPDVPEALQAPAQVPSLFL
NDRLLVYGFIPHCTQATLCALIQEKEFRTMVSTTELQKTTGTMIHKLAARALIRDYEDGI
LHENETSHEMKKQTLKSLIIKLSKENSLITQFTSFVAVEKRDENESPFPDIPKVSELIAK
EDVDFLPYMSWQGEPQEAVRNQSLLASSEWPELRLSKRKHRKIPFSKRKMELSQPEVSED
FEEDGLGVLPAFTSNLERGGVEKLLDLSWTESCKPTATEPLFKKVSPWETSTSSFFPILA
PAVGSYLPPTARAHSPASLSFASYRQVASFGSAAPPRQFDASQFSQGPVPGTCADWIPQS
ASCPTGPPQNPPSSPYCGIVFSGSSLSSAQSAPLQHPGGFTTRPSAGTFPELDSPQLHFS
LPTDPDPIRGFGSYHPSASSPFHFQPSAASLTANLRLPMASALPEALCSQSRTTPVDLCL
LEESVGSLEGSRCPVFAFQSSDTESDELSEVLQDSCFLQIKCDTKDDSILCFLEVKEEDE
IVCIQHWQDAVPWTELLSLQTEDGFWKLTPELGLILNLNTNGLHSFLKQKGIQSLGVKGR
ECLLDLIATMLVLQFIRTRLEKEGIVFKSLMKMDDASISRNIPWAFEAIKQASEWVRRTE
GQYPSICPRLELGNDWDSATKQLLGLQPISTVSPLHRVLHYSQG

Sequence length

1724

Interactions

View interactions

	KEGG		Reactome
	Base excision repair Apoptosis		Nicotinamide salvaging

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	26699384, 31119570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26699384	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	25823930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28526295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	16204055		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Down Syndrome	Down Syndrome	BEFREE	2521372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31002369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	31203137		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	1901731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	1907096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26699384, 31119570, 31203137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29940740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31203137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27873205, 31002369, 31119570		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	16204055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23739867, 26699384, 31203137, 3759579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33811746, 37013346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29940740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28526295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	GWASCAT_DG	29608535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31002369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31203137, 9130606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	9130606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31203137		★★★★★ ★☆☆☆☆ Found in Text Mining only

PARP4 (poly(ADP-ribose) polymerase family member 4)