Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	1429
Gene name	Crystallin zeta
Gene symbol	CRYZ
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1p31.1
Summary	Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called

280

Show/Hide all (280)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030176	hsa-miR-26b-5p	Microarray	19088304
MIRT036137	hsa-miR-1296-5p	CLASH	23622248
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT456032	hsa-miR-3973	PAR-CLIP	20371350
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT456030	hsa-miR-520h	PAR-CLIP	20371350
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	20371350
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT456032	hsa-miR-3973	PAR-CLIP	22012620
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT456030	hsa-miR-520h	PAR-CLIP	22012620
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23446348
MIRT456032	hsa-miR-3973	PAR-CLIP	23446348
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT456030	hsa-miR-520h	PAR-CLIP	23446348
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23446348
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23446348
MIRT456032	hsa-miR-3973	PAR-CLIP	23446348
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT456030	hsa-miR-520h	PAR-CLIP	23446348
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23446348
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT456032	hsa-miR-3973	PAR-CLIP	23592263
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT456030	hsa-miR-520h	PAR-CLIP	23592263
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT456032	hsa-miR-3973	PAR-CLIP	23592263
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT456030	hsa-miR-520h	PAR-CLIP	23592263
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT445858	hsa-miR-3681-5p	PAR-CLIP	22100165
MIRT445857	hsa-miR-6849-5p	PAR-CLIP	22100165
MIRT445856	hsa-miR-376b-5p	PAR-CLIP	22100165
MIRT445855	hsa-miR-376c-5p	PAR-CLIP	22100165
MIRT445854	hsa-miR-1261	PAR-CLIP	22100165
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456032	hsa-miR-3973	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456030	hsa-miR-520h	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	27292025
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	27292025
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	27292025
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	27292025
MIRT456032	hsa-miR-3973	PAR-CLIP	27292025
MIRT456032	hsa-miR-3973	PAR-CLIP	27292025
MIRT456032	hsa-miR-3973	PAR-CLIP	27292025
MIRT456032	hsa-miR-3973	PAR-CLIP	27292025
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT456030	hsa-miR-520h	PAR-CLIP	27292025
MIRT456030	hsa-miR-520h	PAR-CLIP	27292025
MIRT456030	hsa-miR-520h	PAR-CLIP	27292025
MIRT456030	hsa-miR-520h	PAR-CLIP	27292025
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	27292025
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	27292025
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	27292025
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	27292025
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	20371350
MIRT456032	hsa-miR-3973	PAR-CLIP	20371350
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT456030	hsa-miR-520h	PAR-CLIP	20371350
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	20371350
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	22012620
MIRT456032	hsa-miR-3973	PAR-CLIP	22012620
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	22012620
MIRT456030	hsa-miR-520h	PAR-CLIP	22012620
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23446348
MIRT456032	hsa-miR-3973	PAR-CLIP	23446348
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT456030	hsa-miR-520h	PAR-CLIP	23446348
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23446348
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23446348
MIRT456032	hsa-miR-3973	PAR-CLIP	23446348
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23446348
MIRT456030	hsa-miR-520h	PAR-CLIP	23446348
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23446348
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT456032	hsa-miR-3973	PAR-CLIP	23592263
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT456030	hsa-miR-520h	PAR-CLIP	23592263
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT456033	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT456032	hsa-miR-3973	PAR-CLIP	23592263
MIRT456031	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT456030	hsa-miR-520h	PAR-CLIP	23592263
MIRT456029	hsa-miR-323b-3p	PAR-CLIP	23592263
MIRT445858	hsa-miR-3681-5p	PAR-CLIP	22100165
MIRT445857	hsa-miR-6849-5p	PAR-CLIP	22100165
MIRT445856	hsa-miR-376b-5p	PAR-CLIP	22100165
MIRT445855	hsa-miR-376c-5p	PAR-CLIP	22100165
MIRT445854	hsa-miR-1261	PAR-CLIP	22100165
MIRT738287	hsa-miR-105	CLIP-seq
MIRT911204	hsa-miR-3074-3p	CLIP-seq
MIRT911205	hsa-miR-320a	CLIP-seq
MIRT911206	hsa-miR-320b	CLIP-seq
MIRT911207	hsa-miR-320c	CLIP-seq
MIRT911208	hsa-miR-320d	CLIP-seq
MIRT911209	hsa-miR-4429	CLIP-seq
MIRT738286	hsa-miR-4775	CLIP-seq
MIRT911210	hsa-miR-577	CLIP-seq
MIRT911211	hsa-miR-23a	CLIP-seq
MIRT911212	hsa-miR-23b	CLIP-seq
MIRT911213	hsa-miR-23c	CLIP-seq
MIRT911214	hsa-miR-3653	CLIP-seq
MIRT911215	hsa-miR-495	CLIP-seq
MIRT911216	hsa-miR-5096	CLIP-seq
MIRT911217	hsa-miR-556-3p	CLIP-seq
MIRT738285	hsa-miR-758	CLIP-seq
MIRT2206135	hsa-miR-101	CLIP-seq
MIRT2206136	hsa-miR-1275	CLIP-seq
MIRT2206137	hsa-miR-3153	CLIP-seq
MIRT2206138	hsa-miR-4525	CLIP-seq
MIRT2206139	hsa-miR-4645-3p	CLIP-seq
MIRT2206140	hsa-miR-4665-5p	CLIP-seq
MIRT2206141	hsa-miR-4723-5p	CLIP-seq
MIRT2206142	hsa-miR-4735-5p	CLIP-seq
MIRT2206143	hsa-miR-625	CLIP-seq
MIRT2206144	hsa-miR-637	CLIP-seq
MIRT2509298	hsa-miR-1226	CLIP-seq
MIRT2509299	hsa-miR-1229	CLIP-seq
MIRT2509300	hsa-miR-1270	CLIP-seq
MIRT2509301	hsa-miR-1284	CLIP-seq
MIRT2509302	hsa-miR-137	CLIP-seq
MIRT2509303	hsa-miR-142-5p	CLIP-seq
MIRT2509304	hsa-miR-186	CLIP-seq
MIRT911211	hsa-miR-23a	CLIP-seq
MIRT911212	hsa-miR-23b	CLIP-seq
MIRT911213	hsa-miR-23c	CLIP-seq
MIRT2509305	hsa-miR-300	CLIP-seq
MIRT911204	hsa-miR-3074-3p	CLIP-seq
MIRT2509306	hsa-miR-3123	CLIP-seq
MIRT2509307	hsa-miR-3133	CLIP-seq
MIRT2509308	hsa-miR-3182	CLIP-seq
MIRT911205	hsa-miR-320a	CLIP-seq
MIRT911206	hsa-miR-320b	CLIP-seq
MIRT911207	hsa-miR-320c	CLIP-seq
MIRT911208	hsa-miR-320d	CLIP-seq
MIRT2509309	hsa-miR-338-5p	CLIP-seq
MIRT2509310	hsa-miR-340	CLIP-seq
MIRT2509311	hsa-miR-342-3p	CLIP-seq
MIRT2509312	hsa-miR-3647-3p	CLIP-seq
MIRT911214	hsa-miR-3653	CLIP-seq
MIRT2509313	hsa-miR-3664-5p	CLIP-seq
MIRT2509314	hsa-miR-3675-5p	CLIP-seq
MIRT2509315	hsa-miR-381	CLIP-seq
MIRT2509316	hsa-miR-3919	CLIP-seq
MIRT2509317	hsa-miR-3924	CLIP-seq
MIRT2509318	hsa-miR-3925-5p	CLIP-seq
MIRT2509319	hsa-miR-3941	CLIP-seq
MIRT911209	hsa-miR-4429	CLIP-seq
MIRT2509320	hsa-miR-4509	CLIP-seq
MIRT2509321	hsa-miR-4531	CLIP-seq
MIRT2509322	hsa-miR-4643	CLIP-seq
MIRT2509323	hsa-miR-466	CLIP-seq
MIRT2509324	hsa-miR-4666-3p	CLIP-seq
MIRT2509325	hsa-miR-4672	CLIP-seq
MIRT2509326	hsa-miR-4714-5p	CLIP-seq
MIRT2509327	hsa-miR-4725-5p	CLIP-seq
MIRT2509328	hsa-miR-4733-3p	CLIP-seq
MIRT2509329	hsa-miR-4744	CLIP-seq
MIRT2509330	hsa-miR-4756-3p	CLIP-seq
MIRT2509331	hsa-miR-4766-5p	CLIP-seq
MIRT2509332	hsa-miR-4789-3p	CLIP-seq
MIRT2509333	hsa-miR-4799-5p	CLIP-seq
MIRT2509334	hsa-miR-504	CLIP-seq
MIRT911216	hsa-miR-5096	CLIP-seq
MIRT2509335	hsa-miR-513a-3p	CLIP-seq
MIRT2509336	hsa-miR-520g	CLIP-seq
MIRT2509337	hsa-miR-548ag	CLIP-seq
MIRT2509338	hsa-miR-548ai	CLIP-seq
MIRT2509339	hsa-miR-548c-3p	CLIP-seq
MIRT2509340	hsa-miR-548m	CLIP-seq
MIRT911217	hsa-miR-556-3p	CLIP-seq
MIRT2509341	hsa-miR-562	CLIP-seq
MIRT2509342	hsa-miR-570	CLIP-seq
MIRT911210	hsa-miR-577	CLIP-seq
MIRT2509343	hsa-miR-589	CLIP-seq
MIRT2509344	hsa-miR-590-3p	CLIP-seq
MIRT2509345	hsa-miR-615-5p	CLIP-seq
MIRT2509346	hsa-miR-616	CLIP-seq
MIRT2509347	hsa-miR-618	CLIP-seq
MIRT2509348	hsa-miR-620	CLIP-seq
MIRT2509349	hsa-miR-621	CLIP-seq
MIRT2509350	hsa-miR-767-3p	CLIP-seq
MIRT2509351	hsa-miR-885-3p	CLIP-seq
MIRT2509298	hsa-miR-1226	CLIP-seq
MIRT2509301	hsa-miR-1284	CLIP-seq
MIRT2509302	hsa-miR-137	CLIP-seq
MIRT2509303	hsa-miR-142-5p	CLIP-seq
MIRT2509304	hsa-miR-186	CLIP-seq
MIRT2509305	hsa-miR-300	CLIP-seq
MIRT2509306	hsa-miR-3123	CLIP-seq
MIRT2509307	hsa-miR-3133	CLIP-seq
MIRT2509308	hsa-miR-3182	CLIP-seq
MIRT2509309	hsa-miR-338-5p	CLIP-seq
MIRT2509310	hsa-miR-340	CLIP-seq
MIRT2509312	hsa-miR-3647-3p	CLIP-seq
MIRT2509313	hsa-miR-3664-5p	CLIP-seq
MIRT2509315	hsa-miR-381	CLIP-seq
MIRT2509316	hsa-miR-3919	CLIP-seq
MIRT2509318	hsa-miR-3925-5p	CLIP-seq
MIRT2509319	hsa-miR-3941	CLIP-seq
MIRT2509320	hsa-miR-4509	CLIP-seq
MIRT2509322	hsa-miR-4643	CLIP-seq
MIRT2509323	hsa-miR-466	CLIP-seq
MIRT2509324	hsa-miR-4666-3p	CLIP-seq
MIRT2509325	hsa-miR-4672	CLIP-seq
MIRT2509326	hsa-miR-4714-5p	CLIP-seq
MIRT2509327	hsa-miR-4725-5p	CLIP-seq
MIRT2509328	hsa-miR-4733-3p	CLIP-seq
MIRT2509329	hsa-miR-4744	CLIP-seq
MIRT2509330	hsa-miR-4756-3p	CLIP-seq
MIRT2509331	hsa-miR-4766-5p	CLIP-seq
MIRT2509332	hsa-miR-4789-3p	CLIP-seq
MIRT2509333	hsa-miR-4799-5p	CLIP-seq
MIRT2509334	hsa-miR-504	CLIP-seq
MIRT2509335	hsa-miR-513a-3p	CLIP-seq
MIRT2509336	hsa-miR-520g	CLIP-seq
MIRT2509337	hsa-miR-548ag	CLIP-seq
MIRT2509338	hsa-miR-548ai	CLIP-seq
MIRT2509339	hsa-miR-548c-3p	CLIP-seq
MIRT2509340	hsa-miR-548m	CLIP-seq
MIRT2509341	hsa-miR-562	CLIP-seq
MIRT2509342	hsa-miR-570	CLIP-seq
MIRT2509343	hsa-miR-589	CLIP-seq
MIRT2509344	hsa-miR-590-3p	CLIP-seq
MIRT2509347	hsa-miR-618	CLIP-seq
MIRT2509349	hsa-miR-621	CLIP-seq
MIRT2509350	hsa-miR-767-3p	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	17497241
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003960	Function	Quinone reductase (NADPH) activity	IBA
GO:0003960	Function	Quinone reductase (NADPH) activity	IDA	17497241
GO:0003960	Function	Quinone reductase (NADPH) activity	IEA
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	17497241
GO:0007601	Process	Visual perception	TAS	7835889
GO:0008270	Function	Zinc ion binding	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	17497241
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0051289	Process	Protein homotetramerization	IPI	17497241
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0070402	Function	NADPH binding	IBA
GO:0070402	Function	NADPH binding	IDA	17497241
GO:0070404	Function	NADH binding	IDA	17497241

MIM	HGNC	e!Ensembl
123691	2419	ENSG00000116791

Q08257

Protein name

Quinone oxidoreductase (EC 1.6.5.5) (NADPH:quinone reductase) (Zeta-crystallin)

Protein function

Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification o

PDB

1YB5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08240	ADH_N	35 → 124	Alcohol dehydrogenase GroES-like domain	Domain
PF13602	ADH_zinc_N_2	192 → 327		Domain

Tissue specificity

TISSUE SPECIFICITY: Only very low amounts in the lens.

Sequence

MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYS
RKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEK
LDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTA
GTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHG
GRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIG
SQYPLEKVAEAHENIIHGSGATGKMILLL

Sequence length

329

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYZ-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (109)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	11222389, 15382274, 28367062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12041882, 16266898, 17332311, 18444911, 20103721, 24488035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14506737, 16532285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17575500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	10077223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12041882, 24488035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	11916749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21483798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16385446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16385446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29538305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	17575500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	10077223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	28599455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15219943, 21253823, 23464456, 23873104, 24035474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11810042, 15280903, 18511948, 19351655, 19494791, 26687450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	26683602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	19096102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18587252, 22215148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15219943, 21253823, 23464456, 23873104, 24035474, 24219772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10397241, 10591487, 11319169, 11551408, 12711112, 15808404, 17337085, 17428572, 23110137, 23852860, 25729241, 8528266, 9037558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10383895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17332305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	11916749, 21818552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	19007775		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15661231		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	15661231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	12041882, 24488035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	12969868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18820947, 28599455		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28785379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1458556, 17164365, 1737339, 24830960, 7812966, 8912865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11023538, 12529991, 16039674, 16702380, 18444152, 20593958, 20878130, 22215148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	7835889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	18457324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8313512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21989715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	22843503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10447260, 16413497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10447260, 16413497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10447260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16413497, 21989715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27078674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24142529, 28203294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24142529, 28203294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Favism	Favism	BEFREE	11916749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10639573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	10639573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31616304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	21502369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28357584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	9825838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	26723870		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10463613, 12018106, 12393620, 20103721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	11051261, 11840286, 12468438, 24474393, 30623427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15477009, 15763338, 21133623, 25820747, 28191864, 30613335, 30867140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15477009, 25820747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12397416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	10463613, 18457324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11810042, 15280903, 18511948, 19351655, 19494791, 26687450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24142529, 28203294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	8313512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30867140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10397241, 10591487, 11319169, 11551408, 12711112, 15808404, 17337085, 17428572, 23110137, 23852860, 25729241, 8528266, 9037558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17332305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14500388, 20966810, 28639725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18225579, 23109831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22249251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22911602, 24716985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25231218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15219943, 15365958, 15375541, 21253823, 23464456, 23873104, 24035474, 24219772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11122850, 11916749, 12018106, 16143001, 17619904, 25231218, 28291250, 29567345, 29847952, 30615965, 30806580, 30995391, 31480790, 31514018, 31563996, 31726777, 9241663, 9696930 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15661231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	1458556, 17164365, 24830960, 7812966		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27045471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	22669418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	17644186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	16949155, 19736056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21605663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16235982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	23086932, 24142791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15476858, 15809436, 16532285, 17609380, 21378203, 22532167, 26596252, 31324798, 31397998, 8614004, 9659582, 9815750, 9865924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	9825838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17940886, 29108775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29526807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	14592434, 17609380, 24464627, 29291405, 9865924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	15282189, 22669418		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17332305		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14500388, 20966810, 28639725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	9696930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11688992, 15451063, 15694256, 17188257, 18314446, 31358653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	17332311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	20103721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18225579, 23109831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29362432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	8313512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	8313512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12834817, 15151706, 23360829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11679176, 14592434, 25231218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12771035, 24354914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17274053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22911602, 24716985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25231218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25231218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30098460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19715479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	18587252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	30042310		★★★★★ ★☆☆☆☆ Found in Text Mining only

CRYZ (crystallin zeta)