Gene Gene information from NCBI Gene database.
Entrez ID 142680
Gene name Solute carrier family 34 member 3
Gene symbol SLC34A3
Synonyms (NCBI Gene)
HHRHNPT2CNPTIIc
Chromosome 9
Chromosome location 9q34.3
Summary This gene encodes a member of SLC34A transporter family of proteins, and is expressed primarily in the kidney. It is involved in transporting phosphate into cells via sodium cotransport in the renal brush border membrane, and contributes to the maintenanc
SNPs SNP information provided by dbSNP.
28
SNP ID Visualize variation Clinical significance Consequence
rs121918234 G>A,C,T Pathogenic Coding sequence variant, missense variant
rs121918235 C>A,T Pathogenic Coding sequence variant, missense variant
rs121918236 G>A Pathogenic Coding sequence variant, synonymous variant
rs121918237 G>A,T Pathogenic Coding sequence variant, missense variant
rs121918238 C>A,T Pathogenic Genic downstream transcript variant, downstream transcript variant, synonymous variant, stop gained, coding sequence variant, missense variant
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
28
GO ID Ontology Definition Evidence Reference
GO:0005436 Function Sodium:phosphate symporter activity IBA
GO:0005436 Function Sodium:phosphate symporter activity IDA 11880379
GO:0005436 Function Sodium:phosphate symporter activity IEA
GO:0005436 Function Sodium:phosphate symporter activity TAS
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609826 20305 ENSG00000198569
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N130
Protein name Sodium-dependent phosphate transport protein 2C (Sodium-phosphate transport protein 2C) (Na(+)-dependent phosphate cotransporter 2C) (Sodium/inorganic phosphate cotransporter IIC) (Sodium/phosphate cotransporter 2C) (Na(+)/Pi cotransporter 2C) (NaPi-2c) (
Protein function Involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane (PubMed:11880379). The cotransport has a Na(+):Pi stoichiometry of 2:1 and is electroneutral (By similarity). {ECO:0000250|UniProtKB:
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02690 Na_Pi_cotrans 85 230 Na+/Pi-cotransporter Family
PF02690 Na_Pi_cotrans 333 529 Na+/Pi-cotransporter Family
Tissue specificity TISSUE SPECIFICITY: Expressed only in the kidney. {ECO:0000269|PubMed:11880379}.
Sequence
MPSSLPGSQVPHPTLDAVDLVEKTLRNEGTSSSAPVLEEGDTDPWTLPQLKDTSQPWKEL
RVAGRLRRVAGSVLKACGLLGSLYFFICSLDVLSSAFQLLGSKVAGDIFKDNVVLSNPVA
GLVIGVLVTALVQSSSTSSSIVVSMVAAKLLTVRVSVPIIMGVNVGTSITSTLVSMAQSG
DRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASLT
PRAQAPDILK
VLTKPLTHLIVQLDSDMIMSSATGNATNSSLIKHWCGTTGQPTQENSSCGAFGPCTEKNS
TAPADRLPCRHLFAGTELTDLAVGCILLAGSLLVLCGCLVLIVKLLNSVLRGRVAQVVRT
VINADFPFPLGWLGGYLAVLAGAGLTFALQSSSVFTAAVVPLMGVGVISLDRAYPLLLGS
NIGTTTTALLAALASPADRMLSALQVALIHFFFNLAGILLWYLVPALRLPIPLARHFGVV
TARYRWVAGVYLLLGFLLLPLAAFGLSLAGGMELAAVGGPLVGLVLLVI
LVTVLQRRRPA
WLPVRLRSWAWLPVWLHSLEPWDRLVTRCCPCNVCSPPKATTKEAYCYENPEILASQQL
Sequence length 599
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Parathyroid hormone synthesis, secretion and action
Mineral absorption
  Type II Na+/Pi cotransporters
Defective SLC34A3 causes Hereditary hypophosphatemic rickets with hypercalciuria (HHRH)
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
13
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal recessive hypophosphatemic bone disease Likely pathogenic; Pathogenic rs1473192539, rs750178720, rs754054340, rs752222200, rs755196320, rs949841477, rs2131423939, rs2131415051, rs1345816189, rs794729658, rs121918235, rs794729659, rs121918237, rs121918238, rs1554784044
View all (23 more)
RCV005049013
RCV002484811
RCV002504626
RCV002285027
RCV001535840
View all (34 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hypercalciuria Likely pathogenic rs1588844639 RCV001078193
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypophosphataemia or rickets Likely pathogenic; Pathogenic rs199690076 RCV006436691
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SLC34A3-related disorder Pathogenic; Likely pathogenic rs121918238, rs199690076, rs765816079, rs757714479, rs369400414 RCV004745138
RCV003927693
RCV003419882
RCV004746281
RCV004746310
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Conflicting classifications of pathogenicity; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adult Rickets Rickets HPO_DG
★☆☆☆☆
Found in Text Mining only
Barakat syndrome Barakat syndrome Pubtator 32155322 Associate
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone disease Pubtator 29809158 Associate
★☆☆☆☆
Found in Text Mining only
Bone Diseases Metabolic Bone disease Pubtator 39461557 Associate
★☆☆☆☆
Found in Text Mining only
Dwarfism Dwarfism HPO_DG
★☆☆☆☆
Found in Text Mining only
Familial Hypophosphatemic Rickets Hypophosphatemic Rickets LHGDN 18480181
★☆☆☆☆
Found in Text Mining only
Familial Hypophosphatemic Rickets Hypophosphatemic Rickets BEFREE 18523928, 19820004
★☆☆☆☆
Found in Text Mining only
Familial Hypophosphatemic Rickets Hypophosphatemic rickets Pubtator 18996815, 20074341, 29809158 Associate
★☆☆☆☆
Found in Text Mining only
Frontal bossing Frontal bossing HPO_DG
★☆☆☆☆
Found in Text Mining only
Glycosuria Renal Renal glycosuria Pubtator 30798342 Associate
★☆☆☆☆
Found in Text Mining only