PABPC5 (poly(A) binding protein cytoplasmic 5)

Gene

• Entrez ID: 140886
• Gene name: Poly(A) binding protein cytoplasmic 5
• Gene symbol: PABPC5
• Synonyms (NCBI Gene): PABP5
• Chromosome: X
• Chromosome location: Xq21.31
• Summary: This gene encodes a protein that binds to the polyA tail found at the 3` end of most eukaryotic mRNAs. It is thought to play a role in the regulation of mRNA metabolic processes in the cytoplasm. This gene is located in a gene-poor region within the X-spe

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1209663	hsa-miR-101	CLIP-seq
MIRT1209664	hsa-miR-1197	CLIP-seq
MIRT1209665	hsa-miR-1305	CLIP-seq
MIRT1209666	hsa-miR-3613-3p	CLIP-seq
MIRT1209667	hsa-miR-371-5p	CLIP-seq
MIRT1209668	hsa-miR-371b-5p	CLIP-seq
MIRT1209669	hsa-miR-421	CLIP-seq
MIRT1209670	hsa-miR-4282	CLIP-seq
MIRT1209671	hsa-miR-4716-5p	CLIP-seq
MIRT1209672	hsa-miR-4773	CLIP-seq
MIRT1209673	hsa-miR-4778-5p	CLIP-seq
MIRT1209674	hsa-miR-513c	CLIP-seq
MIRT1209675	hsa-miR-514b-5p	CLIP-seq
MIRT1209676	hsa-miR-548b-3p	CLIP-seq
MIRT1209677	hsa-miR-548c-3p	CLIP-seq
MIRT1209678	hsa-miR-656	CLIP-seq
MIRT1209665	hsa-miR-1305	CLIP-seq
MIRT1209669	hsa-miR-421	CLIP-seq
MIRT1209673	hsa-miR-4778-5p	CLIP-seq
MIRT1209665	hsa-miR-1305	CLIP-seq
MIRT2288526	hsa-miR-3682-5p	CLIP-seq
MIRT1209669	hsa-miR-421	CLIP-seq
MIRT1209673	hsa-miR-4778-5p	CLIP-seq
MIRT2288527	hsa-miR-590-3p	CLIP-seq
MIRT1209665	hsa-miR-1305	CLIP-seq
MIRT1209669	hsa-miR-421	CLIP-seq
MIRT1209673	hsa-miR-4778-5p	CLIP-seq
MIRT2431823	hsa-miR-3137	CLIP-seq
MIRT2431824	hsa-miR-4762-5p	CLIP-seq
MIRT2431825	hsa-miR-513b	CLIP-seq
MIRT2586592	hsa-miR-216b	CLIP-seq
MIRT2431824	hsa-miR-4762-5p	CLIP-seq
MIRT2586593	hsa-miR-548l	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	23275553
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23275553
GO:0008143	Function	Poly(A) binding	IBA
GO:0008266	Function	Poly(U) RNA binding	IBA
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:1990904	Component	Ribonucleoprotein complex	IBA

Other IDs

• MIM: 300407
• HGNC: 13629
• e!Ensembl: ENSG00000174740

Protein

• UniProt ID: Q96DU9
• Protein name: Polyadenylate-binding protein 5 (PABP-5) (Poly(A)-binding protein 5)
• Protein function: Binds the poly(A) tail of mRNA. May be involved in cytoplasmic regulatory processes of mRNA metabolism. Can probably bind to cytoplasmic RNA sequences other than poly(A) in vivo (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	20 → 90	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	108 → 176	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	201 → 270	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	304 → 372	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain and in a range of adult tissues.
• Sequence:

  MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLG
  YGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
  ALFYLFSAFGNILSCKVVCDDNGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRF
  KFPEERAAEVRTRDRATFTNVFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKG
  FGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPP
  GVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSSFEEATKAVDE
  MNGRIVGSKPLHVTLGQARRRC

• Sequence length: 382

Pathways

KEGG:

mRNA surveillance pathway
RNA degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTI-NEUTROPHIL ANTIBODY ASSOCIATED VASCULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations