SIRPA (signal regulatory protein alpha)

Gene

• Entrez ID: 140885
• Gene name: Signal regulatory protein alpha
• Gene symbol: SIRPA
• Synonyms (NCBI Gene): BIT, CD172A, MFR, MYD-1, P84, PTPNS1, SHPS1, SIRP
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The protein encoded by this gene is a member of the signal-regulatory-protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT035530	hsa-miR-17-5p	Luciferase reporter assay	23562609
MIRT035531	hsa-miR-20a-5p	Luciferase reporter assay	23562609
MIRT035532	hsa-miR-106a-5p	Luciferase reporter assay	23562609
MIRT040132	hsa-miR-615-3p	CLASH	23622248
MIRT040132	hsa-miR-615-3p	CLASH	23622248
MIRT653801	hsa-miR-5684	HITS-CLIP	23824327
MIRT653800	hsa-miR-4323	HITS-CLIP	23824327
MIRT653799	hsa-miR-3943	HITS-CLIP	23824327
MIRT653798	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT653797	hsa-miR-6783-5p	HITS-CLIP	23824327
MIRT653796	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT653795	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT653794	hsa-miR-4286	HITS-CLIP	23824327
MIRT118340	hsa-miR-4744	HITS-CLIP	23824327
MIRT118335	hsa-miR-4509	HITS-CLIP	23824327
MIRT653793	hsa-miR-1251-5p	HITS-CLIP	23824327
MIRT653792	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT653791	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT653790	hsa-miR-1245a	HITS-CLIP	23824327
MIRT653789	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT653801	hsa-miR-5684	HITS-CLIP	23824327
MIRT653800	hsa-miR-4323	HITS-CLIP	23824327
MIRT653799	hsa-miR-3943	HITS-CLIP	23824327
MIRT653798	hsa-miR-6769a-3p	HITS-CLIP	23824327
MIRT653797	hsa-miR-6783-5p	HITS-CLIP	23824327
MIRT653796	hsa-miR-141-5p	HITS-CLIP	23824327
MIRT653795	hsa-miR-6777-3p	HITS-CLIP	23824327
MIRT653794	hsa-miR-4286	HITS-CLIP	23824327
MIRT118340	hsa-miR-4744	HITS-CLIP	23824327
MIRT118335	hsa-miR-4509	HITS-CLIP	23824327
MIRT653793	hsa-miR-1251-5p	HITS-CLIP	23824327
MIRT653792	hsa-miR-2355-5p	HITS-CLIP	23824327
MIRT653791	hsa-miR-1287-3p	HITS-CLIP	23824327
MIRT653790	hsa-miR-1245a	HITS-CLIP	23824327
MIRT653789	hsa-miR-6731-3p	HITS-CLIP	23824327
MIRT1349864	hsa-miR-1827	CLIP-seq
MIRT1349865	hsa-miR-183	CLIP-seq
MIRT1349866	hsa-miR-1915	CLIP-seq
MIRT1349867	hsa-miR-214	CLIP-seq
MIRT1349868	hsa-miR-2682	CLIP-seq
MIRT1349869	hsa-miR-3163	CLIP-seq
MIRT1349870	hsa-miR-3176	CLIP-seq
MIRT1349871	hsa-miR-335	CLIP-seq
MIRT1349872	hsa-miR-3619-5p	CLIP-seq
MIRT1349873	hsa-miR-3646	CLIP-seq
MIRT1349874	hsa-miR-3647-3p	CLIP-seq
MIRT1349875	hsa-miR-3662	CLIP-seq
MIRT1349876	hsa-miR-3667-3p	CLIP-seq
MIRT1349877	hsa-miR-3922-3p	CLIP-seq
MIRT1349878	hsa-miR-4274	CLIP-seq
MIRT1349879	hsa-miR-4277	CLIP-seq
MIRT1349880	hsa-miR-4291	CLIP-seq
MIRT1349881	hsa-miR-449c	CLIP-seq
MIRT1349882	hsa-miR-4514	CLIP-seq
MIRT1349883	hsa-miR-4530	CLIP-seq
MIRT1349884	hsa-miR-4645-5p	CLIP-seq
MIRT1349885	hsa-miR-4659a-3p	CLIP-seq
MIRT1349886	hsa-miR-4659b-3p	CLIP-seq
MIRT1349887	hsa-miR-4673	CLIP-seq
MIRT1349888	hsa-miR-4687-5p	CLIP-seq
MIRT1349889	hsa-miR-4692	CLIP-seq
MIRT1349890	hsa-miR-4701-5p	CLIP-seq
MIRT1349891	hsa-miR-4726-3p	CLIP-seq
MIRT1349892	hsa-miR-4778-3p	CLIP-seq
MIRT1349893	hsa-miR-588	CLIP-seq
MIRT1349894	hsa-miR-761	CLIP-seq
MIRT1349895	hsa-miR-922	CLIP-seq
MIRT1349896	hsa-miR-1271	CLIP-seq
MIRT1349897	hsa-miR-182	CLIP-seq
MIRT1349898	hsa-miR-3064-5p	CLIP-seq
MIRT1349899	hsa-miR-3150a-3p	CLIP-seq
MIRT1349900	hsa-miR-3175	CLIP-seq
MIRT1349901	hsa-miR-3652	CLIP-seq
MIRT1349902	hsa-miR-4292	CLIP-seq
MIRT1349903	hsa-miR-4308	CLIP-seq
MIRT1349904	hsa-miR-4430	CLIP-seq
MIRT1349905	hsa-miR-4505	CLIP-seq
MIRT1349906	hsa-miR-4712-3p	CLIP-seq
MIRT1349907	hsa-miR-4728-5p	CLIP-seq
MIRT1349908	hsa-miR-491-5p	CLIP-seq
MIRT1349909	hsa-miR-541	CLIP-seq
MIRT1349910	hsa-miR-654-5p	CLIP-seq
MIRT1349911	hsa-miR-659	CLIP-seq
MIRT1349912	hsa-miR-670	CLIP-seq
MIRT1349913	hsa-miR-939	CLIP-seq
MIRT1349914	hsa-miR-96	CLIP-seq
MIRT1349915	hsa-miR-1207-3p	CLIP-seq
MIRT1349916	hsa-miR-140-3p	CLIP-seq
MIRT1349917	hsa-miR-184	CLIP-seq
MIRT1349918	hsa-miR-24	CLIP-seq
MIRT1349919	hsa-miR-3612	CLIP-seq
MIRT1349901	hsa-miR-3652	CLIP-seq
MIRT1349920	hsa-miR-378	CLIP-seq
MIRT1349921	hsa-miR-378b	CLIP-seq
MIRT1349922	hsa-miR-378c	CLIP-seq
MIRT1349923	hsa-miR-378d	CLIP-seq
MIRT1349924	hsa-miR-378e	CLIP-seq
MIRT1349925	hsa-miR-378f	CLIP-seq
MIRT1349926	hsa-miR-378h	CLIP-seq
MIRT1349927	hsa-miR-378i	CLIP-seq
MIRT1349928	hsa-miR-422a	CLIP-seq
MIRT1349929	hsa-miR-4284	CLIP-seq
MIRT1349930	hsa-miR-432	CLIP-seq
MIRT1349904	hsa-miR-4430	CLIP-seq
MIRT1349931	hsa-miR-4781-5p	CLIP-seq
MIRT1349932	hsa-miR-4793-3p	CLIP-seq
MIRT1349933	hsa-miR-4804-5p	CLIP-seq
MIRT1349934	hsa-miR-634	CLIP-seq
MIRT1349935	hsa-miR-650	CLIP-seq
MIRT2103718	hsa-miR-23a	CLIP-seq
MIRT2103719	hsa-miR-23b	CLIP-seq
MIRT2103720	hsa-miR-23c	CLIP-seq
MIRT2103721	hsa-miR-25	CLIP-seq
MIRT2103722	hsa-miR-32	CLIP-seq
MIRT2103723	hsa-miR-323-5p	CLIP-seq
MIRT2103724	hsa-miR-3545-5p	CLIP-seq
MIRT2103725	hsa-miR-3591-3p	CLIP-seq
MIRT2103726	hsa-miR-363	CLIP-seq
MIRT1349876	hsa-miR-3667-3p	CLIP-seq
MIRT2103727	hsa-miR-367	CLIP-seq
MIRT2103728	hsa-miR-4264	CLIP-seq
MIRT2103729	hsa-miR-4328	CLIP-seq
MIRT2103730	hsa-miR-4536	CLIP-seq
MIRT2103731	hsa-miR-4797-3p	CLIP-seq
MIRT2103732	hsa-miR-498	CLIP-seq
MIRT2103733	hsa-miR-711	CLIP-seq
MIRT2103734	hsa-miR-92a	CLIP-seq
MIRT2103735	hsa-miR-92b	CLIP-seq
MIRT2327828	hsa-miR-302a	CLIP-seq
MIRT2327829	hsa-miR-302b	CLIP-seq
MIRT2327830	hsa-miR-302c	CLIP-seq
MIRT2327831	hsa-miR-302d	CLIP-seq
MIRT2327832	hsa-miR-302e	CLIP-seq
MIRT2327833	hsa-miR-3135b	CLIP-seq
MIRT2327834	hsa-miR-372	CLIP-seq
MIRT2327835	hsa-miR-373	CLIP-seq
MIRT2327836	hsa-miR-520a-3p	CLIP-seq
MIRT2327837	hsa-miR-520b	CLIP-seq
MIRT2327838	hsa-miR-520c-3p	CLIP-seq
MIRT2327839	hsa-miR-520d-3p	CLIP-seq
MIRT2327840	hsa-miR-520e	CLIP-seq
MIRT2327841	hsa-miR-520f	CLIP-seq
MIRT2103718	hsa-miR-23a	CLIP-seq
MIRT2103719	hsa-miR-23b	CLIP-seq
MIRT2103720	hsa-miR-23c	CLIP-seq
MIRT2327833	hsa-miR-3135b	CLIP-seq
MIRT2327842	hsa-miR-3184	CLIP-seq
MIRT2327843	hsa-miR-3186-5p	CLIP-seq
MIRT2327844	hsa-miR-423-5p	CLIP-seq
MIRT2103728	hsa-miR-4264	CLIP-seq
MIRT2327845	hsa-miR-4438	CLIP-seq
MIRT2327846	hsa-miR-4473	CLIP-seq
MIRT1349885	hsa-miR-4659a-3p	CLIP-seq
MIRT1349886	hsa-miR-4659b-3p	CLIP-seq
MIRT2327847	hsa-miR-4671-3p	CLIP-seq
MIRT2327848	hsa-miR-4688	CLIP-seq
MIRT1349892	hsa-miR-4778-3p	CLIP-seq
MIRT2103731	hsa-miR-4797-3p	CLIP-seq
MIRT2327849	hsa-miR-5095	CLIP-seq
MIRT2327850	hsa-miR-512-3p	CLIP-seq
MIRT2327841	hsa-miR-520f	CLIP-seq
MIRT2327851	hsa-miR-601	CLIP-seq
MIRT2327852	hsa-miR-621	CLIP-seq
MIRT1349917	hsa-miR-184	CLIP-seq
MIRT1349919	hsa-miR-3612	CLIP-seq
MIRT1349930	hsa-miR-432	CLIP-seq
MIRT1349933	hsa-miR-4804-5p	CLIP-seq
MIRT1349935	hsa-miR-650	CLIP-seq
MIRT2690765	hsa-miR-1202	CLIP-seq
MIRT2690766	hsa-miR-1236	CLIP-seq
MIRT2690767	hsa-miR-1284	CLIP-seq
MIRT2690768	hsa-miR-1343	CLIP-seq
MIRT2690769	hsa-miR-296-3p	CLIP-seq
MIRT2690770	hsa-miR-299-3p	CLIP-seq
MIRT2690771	hsa-miR-3074-5p	CLIP-seq
MIRT2690772	hsa-miR-3170	CLIP-seq
MIRT2690773	hsa-miR-3189-3p	CLIP-seq
MIRT2690774	hsa-miR-320a	CLIP-seq
MIRT2690775	hsa-miR-320b	CLIP-seq
MIRT2690776	hsa-miR-320c	CLIP-seq
MIRT2690777	hsa-miR-320d	CLIP-seq
MIRT2690778	hsa-miR-3653	CLIP-seq
MIRT2690779	hsa-miR-3658	CLIP-seq
MIRT1349876	hsa-miR-3667-3p	CLIP-seq
MIRT2690780	hsa-miR-3691-5p	CLIP-seq
MIRT2690781	hsa-miR-3925-3p	CLIP-seq
MIRT2690782	hsa-miR-3938	CLIP-seq
MIRT2690783	hsa-miR-3972	CLIP-seq
MIRT2690784	hsa-miR-4268	CLIP-seq
MIRT2690785	hsa-miR-4320	CLIP-seq
MIRT2690786	hsa-miR-4429	CLIP-seq
MIRT2690787	hsa-miR-4448	CLIP-seq
MIRT2690788	hsa-miR-4457	CLIP-seq
MIRT2690789	hsa-miR-4491	CLIP-seq
MIRT2690790	hsa-miR-4657	CLIP-seq
MIRT2690791	hsa-miR-4731-3p	CLIP-seq
MIRT2690792	hsa-miR-4752	CLIP-seq
MIRT2690793	hsa-miR-4755-3p	CLIP-seq
MIRT2690794	hsa-miR-4801	CLIP-seq
MIRT2690795	hsa-miR-502-5p	CLIP-seq
MIRT2690796	hsa-miR-515-5p	CLIP-seq
MIRT2690797	hsa-miR-624	CLIP-seq
MIRT1349911	hsa-miR-659	CLIP-seq
MIRT2690798	hsa-miR-766	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	ISS
GO:0005515	Function	Protein binding	IPI	17070842, 24511121, 33961781
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24026300
GO:0005886	Component	Plasma membrane	TAS	9070220
GO:0007155	Process	Cell adhesion	TAS	9070220
GO:0009986	Component	Cell surface	IDA	11509594
GO:0009986	Component	Cell surface	ISS
GO:0009986	Component	Cell surface	TAS	25795378
GO:0010468	Process	Regulation of gene expression	IMP	11509594
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9062191
GO:0016477	Process	Cell migration	ISS
GO:0017124	Function	SH3 domain binding	IEA
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0030695	Function	GTPase regulator activity	ISS
GO:0031665	Process	Negative regulation of lipopolysaccharide-mediated signaling pathway	ISS
GO:0032649	Process	Regulation of type II interferon production	IMP	11509594
GO:0032651	Process	Regulation of interleukin-1 beta production	ISS
GO:0032675	Process	Regulation of interleukin-6 production	ISS
GO:0032680	Process	Regulation of tumor necrosis factor production	IGI	11509594
GO:0032680	Process	Regulation of tumor necrosis factor production	ISS
GO:0032688	Process	Negative regulation of interferon-beta production	ISS
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IEA
GO:0035696	Process	Monocyte extravasation	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	ISS
GO:0045428	Process	Regulation of nitric oxide biosynthetic process	ISS
GO:0046329	Process	Negative regulation of JNK cascade	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IMP	24026300
GO:0050765	Process	Negative regulation of phagocytosis	ISS
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070301	Process	Cellular response to hydrogen peroxide	ISS
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	ISS
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0071346	Process	Cellular response to type II interferon	ISS
GO:0071347	Process	Cellular response to interleukin-1	ISS
GO:0071349	Process	Cellular response to interleukin-12	IMP	11509594
GO:0071641	Process	Negative regulation of macrophage inflammatory protein 1 alpha production	ISS
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	ISS
GO:0086080	Function	Protein binding involved in heterotypic cell-cell adhesion	ISS
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098632	Function	Cell-cell adhesion mediator activity	IPI	11509594
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1990405	Function	Protein antigen binding	IPI	24026300
GO:1990782	Function	Protein tyrosine kinase binding	ISS
GO:2000379	Process	Positive regulation of reactive oxygen species metabolic process	IDA	24511121

Other IDs

• MIM: 602461
• HGNC: 9662
• e!Ensembl: ENSG00000198053

Protein

• UniProt ID: P78324
• Protein name: Tyrosine-protein phosphatase non-receptor type substrate 1 (SHP substrate 1) (SHPS-1) (Brain Ig-like molecule with tyrosine-based activation motifs) (Bit) (CD172 antigen-like family member A) (Inhibitory receptor SHPS-1) (Macrophage fusion receptor) (MyD-
• Protein function: Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth
• PDB: 2JJS, 2JJT, 2UV3, 2WNG, 4CMM, 6BIT, 6NMR, 6NMS, 6NMT, 6NMU, 6NMV, 7KPG, 7ST5, 7YGG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	38 → 145	Immunoglobulin V-set domain	Domain
  PF07654	C1-set	152 → 235	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	256 → 338	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.
• Sequence:

  MEPAGPAPGRLGPLLCLLLAASCAWSGVAGEEELQVIQPDKSVLVAAGETATLRCTATSL
  IPVGPIQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRIGNITPADAGTYY
  CVKFRKGSPDDVEFKSGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTCESHGFSPRDI
  TLKWFKNGNELSDFQTNVDPVGESVSYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL
  RGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQVRKFYPQRLQLTWLENGNVSRTETAS
  TVTENKDGTYNWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSHDLKVSAHPKEQGSNT
  AAENTGSNERNIYIVVGVVCTLLVALLMAALYLVRIRQKKAQGSTSSTRLHEPEKNAREI
  TQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNR
  TPKQPAPKPEPSFSEYASVQVPRK

• Sequence length: 504

Pathways

KEGG:

Efferocytosis
Osteoclast differentiation

Reactome:

Cell surface interactions at the vascular wall
Signal regulatory protein family interactions
Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AZOOSPERMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA 4	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	30843336		★☆☆☆☆ Found in Text Mining only
Acute myeloid leukemia, minimal differentiation	Myeloid Leukemia	BEFREE	23320069		★☆☆☆☆ Found in Text Mining only
Acute myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	23320069		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40037332	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	37063864	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	10856220		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30929259		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	18455510		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	39258954	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30568660	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	14729615, 27900675		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	18820737, 35165267	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30929259		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29992262		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	15359629		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27578867		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37660478, 38111586	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	LHGDN	15359629, 18954403		★☆☆☆☆ Found in Text Mining only
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	BEFREE	18954403		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	24303009	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	30863997	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	30863997		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	14729615		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20705613		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18246042, 20826546	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29473266		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38183060	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	27569062	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35317832	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34495313	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31507080		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	39258954	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33799989, 37049910	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	31541232	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	31507080		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	31507080		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30525058		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30843336		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	30843336, 35421980	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35222883	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34009732	Associate	★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	27095555	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30888336		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	34285260	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38547058	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	32453711	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	19299420		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26116271		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35317832	Stimulate	★☆☆☆☆ Found in Text Mining only
Histiocytosis haematophagic	Histiocytosis Haematophagic	BEFREE	31738750		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28003360		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	27569062	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38183060	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	29473266		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	30863997	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29329362		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30888336		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31370677		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	9414269	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23320069, 28061465, 9414269	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	27010069	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23320069		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	27793032		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27793032		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	38111586	Associate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	22990013		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	34525171	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	31611550	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	31611550		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20705613		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30525058		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27793032		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	28383029		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12124321, 24215318, 26077800, 28077173, 28086180, 28286286, 29298051, 29473266, 29873856		★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	15784688		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33504439	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27793032	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	26495845		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21169408, 21996737, 26116271, 27793032, 28086180, 29158380, 29473266, 30105024, 30738349		★☆☆☆☆ Found in Text Mining only
Nephrosis, congenital	Nephrosis, Congenital	BEFREE	22747997		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28111925		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	24162948		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	24303009		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	28383029		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	28383029	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23791107	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31322787		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31681304	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	39258954	Associate	★☆☆☆☆ Found in Text Mining only
Persistent Fetal Circulation Syndrome	Persistent Fetal Circulation	BEFREE	24722050		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	40507944	Inhibit	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18455510		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36478349	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30962222	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27793032		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27793032, 31861233	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	38183060	Associate	★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	19205026		★☆☆☆☆ Found in Text Mining only