C20orf173 (chromosome 20 open reading frame 173)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 140873
Gene name Chromosome 20 open reading frame 173
Gene symbol C20orf173
Synonyms (NCBI Gene)
dJ477O4.4
Chromosome 20
Chromosome location 20q11.22
miRNA miRNA information provided by mirtarbase database.
3
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018570 hsa-miR-335-5p Microarray 18185580
MIRT047225 hsa-miR-181b-5p CLASH 23622248
MIRT041162 hsa-miR-181d-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
7 Show/Hide all (7)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003836 Function Beta-galactoside (CMP) alpha-2,3-sialyltransferase activity IBA
GO:0005515 Function Protein binding IPI 32296183
GO:0006486 Process Protein glycosylation IBA
GO:0008373 Function Sialyltransferase activity IEA
GO:0010706 Process Ganglioside biosynthetic process via lactosylceramide IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96LM9
Protein name Uncharacterized protein C20orf173
Family and domains
Sequence 
MLSGPHPSPTFRPNPCPWPCLHSLWMEISPTQLCFLSPGPSPQSPSCCFQGMNSGSELGK
LWRKLFKGIPRLSVSHFDFYCGTCVLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQ
LEMLLRKLSDLVWTSDALSDKILEDGLVP
Sequence length 149
Interactions View interactions

No strongly related genes found yet for C20orf173.

No additional diseases found yet through genes similar to C20orf173.