Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	140767
Gene name	Neurensin 1
Gene symbol	NRSN1
Synonyms (NCBI Gene)	VMPp24
Chromosome	6
Chromosome location	6p22.3

123

Show/Hide all (123)

miRTarBase ID	miRNA	Experiments
MIRT1194439	hsa-miR-1207-5p	CLIP-seq
MIRT1194440	hsa-miR-1225-3p	CLIP-seq
MIRT1194441	hsa-miR-1233	CLIP-seq
MIRT1194442	hsa-miR-1252	CLIP-seq
MIRT1194443	hsa-miR-196a	CLIP-seq
MIRT1194444	hsa-miR-196b	CLIP-seq
MIRT1194445	hsa-miR-2114	CLIP-seq
MIRT1194446	hsa-miR-3154	CLIP-seq
MIRT1194447	hsa-miR-3665	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194450	hsa-miR-377	CLIP-seq
MIRT1194451	hsa-miR-3922-5p	CLIP-seq
MIRT1194452	hsa-miR-3929	CLIP-seq
MIRT1194453	hsa-miR-411	CLIP-seq
MIRT1194454	hsa-miR-4419b	CLIP-seq
MIRT1194455	hsa-miR-4433	CLIP-seq
MIRT1194456	hsa-miR-4478	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194458	hsa-miR-4736	CLIP-seq
MIRT1194459	hsa-miR-4762-5p	CLIP-seq
MIRT1194460	hsa-miR-4763-3p	CLIP-seq
MIRT1194461	hsa-miR-4778-3p	CLIP-seq
MIRT1194462	hsa-miR-485-5p	CLIP-seq
MIRT1194463	hsa-miR-550a	CLIP-seq
MIRT1194464	hsa-miR-665	CLIP-seq
MIRT1194465	hsa-miR-764	CLIP-seq
MIRT1194466	hsa-miR-890	CLIP-seq
MIRT1194439	hsa-miR-1207-5p	CLIP-seq
MIRT1194440	hsa-miR-1225-3p	CLIP-seq
MIRT1194441	hsa-miR-1233	CLIP-seq
MIRT1194442	hsa-miR-1252	CLIP-seq
MIRT2056507	hsa-miR-1293	CLIP-seq
MIRT1194445	hsa-miR-2114	CLIP-seq
MIRT1194447	hsa-miR-3665	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194451	hsa-miR-3922-5p	CLIP-seq
MIRT1194452	hsa-miR-3929	CLIP-seq
MIRT1194454	hsa-miR-4419b	CLIP-seq
MIRT1194455	hsa-miR-4433	CLIP-seq
MIRT1194456	hsa-miR-4478	CLIP-seq
MIRT2056508	hsa-miR-4483	CLIP-seq
MIRT2056509	hsa-miR-4651	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194458	hsa-miR-4736	CLIP-seq
MIRT1194460	hsa-miR-4763-3p	CLIP-seq
MIRT1194462	hsa-miR-485-5p	CLIP-seq
MIRT1194463	hsa-miR-550a	CLIP-seq
MIRT2056510	hsa-miR-608	CLIP-seq
MIRT2056511	hsa-miR-637	CLIP-seq
MIRT1194464	hsa-miR-665	CLIP-seq
MIRT1194465	hsa-miR-764	CLIP-seq
MIRT1194466	hsa-miR-890	CLIP-seq
MIRT1194440	hsa-miR-1225-3p	CLIP-seq
MIRT1194441	hsa-miR-1233	CLIP-seq
MIRT2284978	hsa-miR-141	CLIP-seq
MIRT2284979	hsa-miR-200a	CLIP-seq
MIRT1194445	hsa-miR-2114	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194451	hsa-miR-3922-5p	CLIP-seq
MIRT1194452	hsa-miR-3929	CLIP-seq
MIRT1194454	hsa-miR-4419b	CLIP-seq
MIRT1194455	hsa-miR-4433	CLIP-seq
MIRT1194456	hsa-miR-4478	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194462	hsa-miR-485-5p	CLIP-seq
MIRT1194463	hsa-miR-550a	CLIP-seq
MIRT1194464	hsa-miR-665	CLIP-seq
MIRT1194465	hsa-miR-764	CLIP-seq
MIRT1194466	hsa-miR-890	CLIP-seq
MIRT1194445	hsa-miR-2114	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194452	hsa-miR-3929	CLIP-seq
MIRT1194454	hsa-miR-4419b	CLIP-seq
MIRT1194456	hsa-miR-4478	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194462	hsa-miR-485-5p	CLIP-seq
MIRT1194463	hsa-miR-550a	CLIP-seq
MIRT1194465	hsa-miR-764	CLIP-seq
MIRT1194466	hsa-miR-890	CLIP-seq
MIRT2431644	hsa-miR-3123	CLIP-seq
MIRT2431645	hsa-miR-3919	CLIP-seq
MIRT2431646	hsa-miR-4716-5p	CLIP-seq
MIRT2431647	hsa-miR-4756-3p	CLIP-seq
MIRT2431644	hsa-miR-3123	CLIP-seq
MIRT2431645	hsa-miR-3919	CLIP-seq
MIRT2431646	hsa-miR-4716-5p	CLIP-seq
MIRT2431647	hsa-miR-4756-3p	CLIP-seq
MIRT2431644	hsa-miR-3123	CLIP-seq
MIRT2431645	hsa-miR-3919	CLIP-seq
MIRT2431646	hsa-miR-4716-5p	CLIP-seq
MIRT2431647	hsa-miR-4756-3p	CLIP-seq
MIRT1194439	hsa-miR-1207-5p	CLIP-seq
MIRT1194445	hsa-miR-2114	CLIP-seq
MIRT1194447	hsa-miR-3665	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194452	hsa-miR-3929	CLIP-seq
MIRT1194454	hsa-miR-4419b	CLIP-seq
MIRT1194456	hsa-miR-4478	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194458	hsa-miR-4736	CLIP-seq
MIRT1194460	hsa-miR-4763-3p	CLIP-seq
MIRT1194462	hsa-miR-485-5p	CLIP-seq
MIRT1194463	hsa-miR-550a	CLIP-seq
MIRT1194465	hsa-miR-764	CLIP-seq
MIRT1194466	hsa-miR-890	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194445	hsa-miR-2114	CLIP-seq
MIRT1194448	hsa-miR-3689a-3p	CLIP-seq
MIRT1194449	hsa-miR-3689c	CLIP-seq
MIRT1194452	hsa-miR-3929	CLIP-seq
MIRT1194454	hsa-miR-4419b	CLIP-seq
MIRT1194456	hsa-miR-4478	CLIP-seq
MIRT1194457	hsa-miR-4728-5p	CLIP-seq
MIRT1194462	hsa-miR-485-5p	CLIP-seq
MIRT1194463	hsa-miR-550a	CLIP-seq
MIRT1194466	hsa-miR-890	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0007399	Process	Nervous system development	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	ISS
GO:0016020	Component	Membrane	IEA
GO:0030133	Component	Transport vesicle	IBA
GO:0030133	Component	Transport vesicle	IEA
GO:0030133	Component	Transport vesicle	TAS	12463420
GO:0030426	Component	Growth cone	IEA
GO:0030426	Component	Growth cone	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS

MIM	HGNC	e!Ensembl
616630	17881	ENSG00000152954

Q8IZ57

Protein name

Neurensin-1 (Neuro-p24) (Vesicular membrane protein of 24 kDa) (Vesicular membrane protein p24)

Protein function

May play an important role in neural organelle transport, and in transduction of nerve signals or in nerve growth. May play a role in neurite extension. May play a role in memory consolidation (By similarity). {ECO:0000250|UniProtKB:P97799, ECO:

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14927	Neurensin	23 → 153		Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain. Not detectable in other tissues tested. {ECO:0000269|PubMed:12463420}.

Sequence

MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSV
FWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGA
VLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIP
VTLSRVQNVQPLLAT

Sequence length

195

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	6090008, 6331549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	19362708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	19362708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	19362708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	26039340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	1537894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29241676		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon Carcinoma	Colon Carcinoma	BEFREE	7797233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	19362708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	15717286, 16385449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	BEFREE	16385449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	31122520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	GENOMICS_ENGLAND_DG	22325380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	29654647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29654647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GENOMICS_ENGLAND_DG	22325380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	GENOMICS_ENGLAND_DG	22325380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10555209, 11114129, 12925157, 1883515, 2170147, 22090105, 28222792, 8083609, 8857018, 9820572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	16171885		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10848783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	6090008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	9117038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28963391		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29241676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	26039340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	9811743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16324750, 9811743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29241676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	6090008, 8174106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12072202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	31765002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	16324750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	29064472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	8174106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	2692124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	9811743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	1537894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	BEFREE	15161643, 23486877		★★★★★ ★☆☆☆☆ Found in Text Mining only

NRSN1 (neurensin 1)