Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	140766
Gene name	ADAM metallopeptidase with thrombospondin type 1 motif 14
Gene symbol	ADAMTS14
Synonyms (NCBI Gene)	-
Chromosome	10
Chromosome location	10q22.1
Summary	This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin

Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT496781	hsa-miR-4667-5p	PAR-CLIP	22291592
MIRT496780	hsa-miR-4700-5p	PAR-CLIP	22291592
MIRT496779	hsa-miR-8089	PAR-CLIP	22291592
MIRT496778	hsa-miR-637	PAR-CLIP	22291592
MIRT496777	hsa-miR-7155-5p	PAR-CLIP	22291592
MIRT496776	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT496775	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT496774	hsa-miR-3926	PAR-CLIP	22291592
MIRT496773	hsa-miR-6731-5p	PAR-CLIP	22291592
MIRT496772	hsa-miR-8085	PAR-CLIP	22291592
MIRT496771	hsa-miR-3175	PAR-CLIP	22291592
MIRT496770	hsa-miR-1343-5p	PAR-CLIP	22291592
MIRT496769	hsa-miR-939-5p	PAR-CLIP	22291592
MIRT496768	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT496767	hsa-miR-6762-5p	PAR-CLIP	22291592
MIRT496766	hsa-miR-6845-5p	PAR-CLIP	22291592
MIRT496765	hsa-miR-4314	PAR-CLIP	22291592
MIRT496764	hsa-miR-3150a-3p	PAR-CLIP	22291592
MIRT496763	hsa-miR-6763-5p	PAR-CLIP	22291592
MIRT496781	hsa-miR-4667-5p	PAR-CLIP	22291592
MIRT496780	hsa-miR-4700-5p	PAR-CLIP	22291592
MIRT496779	hsa-miR-8089	PAR-CLIP	22291592
MIRT496778	hsa-miR-637	PAR-CLIP	22291592
MIRT496777	hsa-miR-7155-5p	PAR-CLIP	22291592
MIRT496776	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT496775	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT496774	hsa-miR-3926	PAR-CLIP	22291592
MIRT496773	hsa-miR-6731-5p	PAR-CLIP	22291592
MIRT496772	hsa-miR-8085	PAR-CLIP	22291592
MIRT496771	hsa-miR-3175	PAR-CLIP	22291592
MIRT496770	hsa-miR-1343-5p	PAR-CLIP	22291592
MIRT496769	hsa-miR-939-5p	PAR-CLIP	22291592
MIRT496768	hsa-miR-6825-5p	PAR-CLIP	22291592
MIRT496767	hsa-miR-6762-5p	PAR-CLIP	22291592
MIRT496766	hsa-miR-6845-5p	PAR-CLIP	22291592
MIRT496765	hsa-miR-4314	PAR-CLIP	22291592
MIRT496764	hsa-miR-3150a-3p	PAR-CLIP	22291592
MIRT496763	hsa-miR-6763-5p	PAR-CLIP	22291592
MIRT766370	hsa-let-7a	CLIP-seq
MIRT766371	hsa-let-7b	CLIP-seq
MIRT766372	hsa-let-7c	CLIP-seq
MIRT766373	hsa-let-7d	CLIP-seq
MIRT766374	hsa-let-7e	CLIP-seq
MIRT766375	hsa-let-7f	CLIP-seq
MIRT766376	hsa-let-7g	CLIP-seq
MIRT766377	hsa-let-7i	CLIP-seq
MIRT766378	hsa-miR-202	CLIP-seq
MIRT766379	hsa-miR-2277-3p	CLIP-seq
MIRT766380	hsa-miR-3660	CLIP-seq
MIRT766381	hsa-miR-4458	CLIP-seq
MIRT766382	hsa-miR-4500	CLIP-seq
MIRT766383	hsa-miR-4514	CLIP-seq
MIRT766384	hsa-miR-4526	CLIP-seq
MIRT766385	hsa-miR-4663	CLIP-seq
MIRT766386	hsa-miR-4692	CLIP-seq
MIRT766387	hsa-miR-4732-3p	CLIP-seq
MIRT766388	hsa-miR-486-3p	CLIP-seq
MIRT766389	hsa-miR-628-5p	CLIP-seq
MIRT766390	hsa-miR-940	CLIP-seq
MIRT766391	hsa-miR-98	CLIP-seq
MIRT766392	hsa-miR-218	CLIP-seq
MIRT766393	hsa-miR-3646	CLIP-seq
MIRT766394	hsa-miR-3662	CLIP-seq
MIRT766395	hsa-miR-4327	CLIP-seq
MIRT766396	hsa-miR-636	CLIP-seq
MIRT1925783	hsa-miR-1262	CLIP-seq
MIRT1925784	hsa-miR-3065-3p	CLIP-seq
MIRT1925785	hsa-miR-3120-3p	CLIP-seq
MIRT1925786	hsa-miR-3659	CLIP-seq
MIRT1925787	hsa-miR-4658	CLIP-seq
MIRT1925788	hsa-miR-4701-3p	CLIP-seq
MIRT1925789	hsa-miR-574-5p	CLIP-seq
MIRT1925790	hsa-miR-600	CLIP-seq
MIRT1925791	hsa-miR-938	CLIP-seq
MIRT2167123	hsa-miR-1972	CLIP-seq
MIRT2167124	hsa-miR-29a	CLIP-seq
MIRT2167125	hsa-miR-29b	CLIP-seq
MIRT2167126	hsa-miR-29c	CLIP-seq
MIRT1925784	hsa-miR-3065-3p	CLIP-seq
MIRT2167127	hsa-miR-338-3p	CLIP-seq
MIRT2167128	hsa-miR-4286	CLIP-seq
MIRT2167129	hsa-miR-4530	CLIP-seq
MIRT2167130	hsa-miR-4733-3p	CLIP-seq
MIRT2167131	hsa-miR-508-5p	CLIP-seq
MIRT2167132	hsa-miR-766	CLIP-seq
MIRT2383889	hsa-miR-1289	CLIP-seq
MIRT2383890	hsa-miR-2115	CLIP-seq
MIRT2383891	hsa-miR-3198	CLIP-seq
MIRT2383892	hsa-miR-3607-3p	CLIP-seq
MIRT2383893	hsa-miR-3686	CLIP-seq
MIRT2383894	hsa-miR-4294	CLIP-seq
MIRT2383895	hsa-miR-4309	CLIP-seq
MIRT2383896	hsa-miR-4487	CLIP-seq
MIRT766388	hsa-miR-486-3p	CLIP-seq
MIRT2383897	hsa-miR-516b	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence
GO:0004222	Function	Metalloendopeptidase activity	IBA
GO:0004222	Function	Metalloendopeptidase activity	IEA
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030198	Process	Extracellular matrix organization	IBA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030199	Process	Collagen fibril organization	IEA
GO:0030199	Process	Collagen fibril organization	TAS
GO:0030574	Process	Collagen catabolic process	IEA
GO:0031012	Component	Extracellular matrix	IBA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
607506	14899	ENSG00000138316

Q8WXS8

Protein name

A disintegrin and metalloproteinase with thrombospondin motifs 14 (ADAM-TS 14) (ADAM-TS14) (ADAMTS-14) (EC 3.4.24.-)

Protein function

Has aminoprocollagen type I processing activity in the absence of ADAMTS2 (PubMed:11741898). Seems to be synthesized as a latent enzyme that requires activation to display aminoprocollagen peptidase activity (PubMed:11741898). Cleaves lysyl oxid

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01562	Pep_M12B_propep	39 → 207	Reprolysin family propeptide	Family
PF01421	Reprolysin	259 → 460	Reprolysin (M12B) family zinc metalloprotease	Domain
PF17771	ADAM_CR_2	472 → 541	ADAM cysteine-rich domain	Domain
PF00090	TSP_1	556 → 606	Thrombospondin type 1 domain	Domain
PF05986	ADAM_spacer1	714 → 829	ADAM-TS Spacer 1	Family
PF19030	TSP1_ADAMTS	851 → 906		Domain
PF19030	TSP1_ADAMTS	911 → 968		Domain
PF19030	TSP1_ADAMTS	972 → 1021		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in retina and at low levels in brain, lung and placenta (PubMed:11779638). High expression in fetal tissues (PubMed:11867212). {ECO:0000269|PubMed:11779638, ECO:0000269|PubMed:11867212}.

Sequence

MAPLRALLSYLLPLHCALCAAAGSRTPELHLSGKLSDYGVTVPCSTDFRGRFLSHVVSGP
AAASAGSMVVDTPPTLPRHSSHLRVARSPLHPGGTLWPGRVGRHSLYFNVTVFGKELHLR
LRPNRRLVVPGSSVEWQEDFRELFRQPLRQECVYTGGVTGMPGAAVAISNCDGLAGLIRT
DSTDFFIEPLERGQQEKEASGRTHVVYRREAVQQEWAEPDGDLHNEAFGLGDLPNLLGLV
GDQLGDTERKRRHAKPGSYSIEVLLVVDDSVVRFHGKEHVQNYVLTLMNIVDEIYHDESL
GVHINIALVRLIMVGYRQSLSLIERGNPSRSLEQVCRWAHSQQRQDPSHAEHHDHVVFLT
RQDFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVIAHETGHVLGMEHDGQGNGCADETS
LGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFDPAWPQPPELPGINYSMDE
QCRFDFGSGYQTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECAPGKWCFKGHC
IWKSPEQTYGQDGGWSSWTKFGSCSRSCGGGVRSRSRSCNNPSPAYGGRLCLGPMFEYQV
CNSEECPGTYEDFRAQQCAKRNSYYVHQNAKHSWVPYEPDDDAQKCELICQSADTGDVVF
MNQVVHDGTRCSYRDPYSVCARGECVPVGCDKEVGSMKADDKCGVCGGDNSHCRTVKGTL
GKASKQAGALKLVQIPAGARHIQIEALEKSPHRIVVKNQVTGSFILNPKGKEATSRTFTA
MGLEWEDAVEDAKESLKTSGPLPEAIAILALPPTEGGPRSSLAYKYVIHEDLLPLIGSNN
VLLEEMDTYEWALKSWAPCSKACGGGIQFTKYGCRRRRDHHMVQRHLCDHKKRPKPIRRR
CNQHPCSQPVWVTEEWGACSRSCGKLGVQTRGIQCLLPLSNGTHKVMPAKACAGDRPEAR
RPCLRVPCPAQWRLGAWSQCSATCGEGIQQRQVVCRTNANSLGHCEGDRPDTVQVCSLPA
CGGNHQNSTVRADVWELGTPEGQWVPQSEPLHPINKISSTEPCTGDRSVFCQMEVLDRYC
SIPGYHRLCCVSCIKKASGPNPGPDPGPTSLPPFSTPGSPLPGPQDPADAAEPPGKPTGS
EDHQHGRATQLPGALDTSSPGTQHPFAPETPIPGASWSISPTTPGGLPWGWTQTPTPVPE
DKGQPGEDLRHPGTSLPAASPVT

Sequence length

1223

Interactions

View interactions

	Reactome
			Collagen biosynthesis and modifying enzymes Defective B3GALTL causes Peters-plus syndrome (PpS) O-glycosylation of TSR domain-containing proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fraser syndrome 3	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS, RELAPSING-REMITTING	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRION DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	Pubtator	27463966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	22694930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	27463966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27463966, 28231306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28231306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25638164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25638164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	14730609, 18790654, 24301791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	17336841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EHLERS-DANLOS SYNDROME, DERMATOSPARAXIS TYPE	Dermatosparaxis Ehlers-Danlos Syndrome	BEFREE	16556917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Disease	Gestational trophoblastic disease	Pubtator	24786121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36681777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27463966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28231306, 30317540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27463966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27463966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15913795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30317540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	14730609	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18790654, 24301791, 30266746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	18790654, 24301791, 30266746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	24301791, 30266746		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAMTS14 (ADAM metallopeptidase with thrombospondin type 1 motif 14)