Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	140738
Gene name	Transmembrane protein 37
Gene symbol	TMEM37
Synonyms (NCBI Gene)	PRPR1
Chromosome	2
Chromosome location	2q14.2

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT459460	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT459459	hsa-miR-4272	PAR-CLIP	23592263
MIRT459458	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT459457	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT459456	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT459454	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT459455	hsa-miR-4419a	PAR-CLIP	23592263
MIRT459453	hsa-miR-4510	PAR-CLIP	23592263
MIRT459452	hsa-miR-6127	PAR-CLIP	23592263
MIRT459451	hsa-miR-6129	PAR-CLIP	23592263
MIRT459450	hsa-miR-6130	PAR-CLIP	23592263
MIRT459449	hsa-miR-6133	PAR-CLIP	23592263
MIRT459447	hsa-miR-5702	PAR-CLIP	23592263
MIRT459448	hsa-miR-4533	PAR-CLIP	23592263
MIRT459446	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT459445	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT459444	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT459443	hsa-miR-4697-3p	PAR-CLIP	23592263
MIRT459442	hsa-miR-7159-5p	PAR-CLIP	23592263
MIRT459441	hsa-miR-505-3p	PAR-CLIP	23592263
MIRT459440	hsa-miR-421	PAR-CLIP	23592263
MIRT459439	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT459460	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT459459	hsa-miR-4272	PAR-CLIP	23592263
MIRT459458	hsa-miR-4709-5p	PAR-CLIP	23592263
MIRT459457	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT459456	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT459454	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT459455	hsa-miR-4419a	PAR-CLIP	23592263
MIRT459453	hsa-miR-4510	PAR-CLIP	23592263
MIRT459452	hsa-miR-6127	PAR-CLIP	23592263
MIRT459451	hsa-miR-6129	PAR-CLIP	23592263
MIRT459450	hsa-miR-6130	PAR-CLIP	23592263
MIRT459449	hsa-miR-6133	PAR-CLIP	23592263
MIRT459447	hsa-miR-5702	PAR-CLIP	23592263
MIRT459448	hsa-miR-4533	PAR-CLIP	23592263
MIRT459446	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT459445	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT459444	hsa-miR-6716-5p	PAR-CLIP	23592263
MIRT459443	hsa-miR-4697-3p	PAR-CLIP	23592263
MIRT459442	hsa-miR-7159-5p	PAR-CLIP	23592263
MIRT459441	hsa-miR-505-3p	PAR-CLIP	23592263
MIRT459440	hsa-miR-421	PAR-CLIP	23592263
MIRT459439	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT1436871	hsa-miR-1909	CLIP-seq
MIRT1436872	hsa-miR-320a	CLIP-seq
MIRT1436873	hsa-miR-320b	CLIP-seq
MIRT1436874	hsa-miR-320c	CLIP-seq
MIRT1436875	hsa-miR-320d	CLIP-seq
MIRT1436876	hsa-miR-3622b-5p	CLIP-seq
MIRT1436877	hsa-miR-3944-5p	CLIP-seq
MIRT1436878	hsa-miR-4303	CLIP-seq
MIRT1436879	hsa-miR-4318	CLIP-seq
MIRT1436880	hsa-miR-4429	CLIP-seq
MIRT1436881	hsa-miR-4642	CLIP-seq
MIRT1436882	hsa-miR-4649-3p	CLIP-seq
MIRT1436883	hsa-miR-4693-5p	CLIP-seq
MIRT1436884	hsa-miR-4761-3p	CLIP-seq
MIRT1436885	hsa-miR-4786-3p	CLIP-seq
MIRT1436886	hsa-miR-892a	CLIP-seq
MIRT2130940	hsa-miR-2053	CLIP-seq
MIRT2130941	hsa-miR-2115	CLIP-seq
MIRT2130942	hsa-miR-218	CLIP-seq
MIRT2130943	hsa-miR-2355-5p	CLIP-seq
MIRT2130944	hsa-miR-2392	CLIP-seq
MIRT2130945	hsa-miR-324-5p	CLIP-seq
MIRT2130946	hsa-miR-338-3p	CLIP-seq
MIRT2130947	hsa-miR-3647-3p	CLIP-seq
MIRT2130948	hsa-miR-3688-3p	CLIP-seq
MIRT2130949	hsa-miR-4455	CLIP-seq
MIRT2130950	hsa-miR-4694-5p	CLIP-seq
MIRT2130951	hsa-miR-516a-3p	CLIP-seq
MIRT2130952	hsa-miR-569	CLIP-seq
MIRT2130953	hsa-miR-609	CLIP-seq
MIRT2130954	hsa-miR-636	CLIP-seq
MIRT2130944	hsa-miR-2392	CLIP-seq
MIRT2352196	hsa-miR-31	CLIP-seq
MIRT2352197	hsa-miR-3128	CLIP-seq
MIRT2130948	hsa-miR-3688-3p	CLIP-seq
MIRT2352198	hsa-miR-4643	CLIP-seq
MIRT2352199	hsa-miR-4719	CLIP-seq
MIRT2352200	hsa-miR-642b	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence
GO:0005244	Function	Voltage-gated monoatomic ion channel activity	IEA
GO:0005262	Function	Calcium channel activity	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006816	Process	Calcium ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0070588	Process	Calcium ion transmembrane transport	IEA

MIM	HGNC	e!Ensembl
618831	18216	ENSG00000171227

Q8WXS4

Protein name

Voltage-dependent calcium channel gamma-like subunit (Neuronal voltage-gated calcium channel gamma-like subunit) (Transmembrane protein 37)

Protein function

Thought to stabilize the calcium channel in an inactivated (closed) state. Modulates calcium current when coexpressed with CACNA1G (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15108	TMEM37	7 → 187	Voltage-dependent calcium channel gamma-like subunit protein family	Family

Sequence

MTAVGVQAQRPLGQRQPRRSFFESFIRTLIITCVALAVVLSSVSICDGHWLLAEDRLFGL
WHFCTTTNQTICFRDLGQAHVPGLAVGMGLVRSVGALAVVAAIFGLEFLMVSQLCEDKHS
QCKWVMGSILLLVSFVLSSGGLLGFVILLRNQVTLIGFTLMFWCEFTASFLLFLNAISGL
HINSITHPWE

Sequence length

190

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	21489049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23105141, 28468826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	21489049		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	21489049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29653552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29185012, 32705173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	12829610	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	37900130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	28468826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17412886, 22495388, 9326217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	23105141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28254787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30880498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29653552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23105141	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22480845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30880498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30880498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	21489049		★★★★★ ★☆☆☆☆ Found in Text Mining only

TMEM37 (transmembrane protein 37)