MACROD2 (mono-ADP ribosylhydrolase 2)

Gene

• Entrez ID: 140733
• Gene name: Mono-ADP ribosylhydrolase 2
• Gene symbol: MACROD2
• Synonyms (NCBI Gene): C20orf133, C2orf133
• Chromosome: 20
• Chromosome location: 20p12.1
• Summary: The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. [provided by RefSeq, May 2017]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT712425	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT712424	hsa-miR-4292	HITS-CLIP	19536157
MIRT712423	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT712422	hsa-miR-6852-5p	HITS-CLIP	19536157
MIRT712421	hsa-miR-4725-5p	HITS-CLIP	19536157
MIRT712420	hsa-miR-4252	HITS-CLIP	19536157
MIRT712419	hsa-miR-486-3p	HITS-CLIP	19536157
MIRT712418	hsa-miR-7973	HITS-CLIP	19536157
MIRT712417	hsa-miR-6808-3p	HITS-CLIP	19536157
MIRT712425	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT712424	hsa-miR-4292	HITS-CLIP	19536157
MIRT712423	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT712422	hsa-miR-6852-5p	HITS-CLIP	19536157
MIRT712421	hsa-miR-4725-5p	HITS-CLIP	19536157
MIRT712420	hsa-miR-4252	HITS-CLIP	19536157
MIRT712419	hsa-miR-486-3p	HITS-CLIP	19536157
MIRT712418	hsa-miR-7973	HITS-CLIP	19536157
MIRT712417	hsa-miR-6808-3p	HITS-CLIP	19536157
MIRT667494	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT667493	hsa-miR-6841-3p	HITS-CLIP	23824327
MIRT667492	hsa-miR-1915-5p	HITS-CLIP	23824327
MIRT667491	hsa-miR-4786-3p	HITS-CLIP	23824327
MIRT667490	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT641748	hsa-miR-618	HITS-CLIP	23824327
MIRT641747	hsa-miR-1470	HITS-CLIP	23824327
MIRT641746	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT641745	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT641744	hsa-miR-486-5p	HITS-CLIP	23824327
MIRT641743	hsa-miR-4469	HITS-CLIP	23824327
MIRT641742	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT641741	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT712425	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT712424	hsa-miR-4292	HITS-CLIP	19536157
MIRT712423	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT712422	hsa-miR-6852-5p	HITS-CLIP	19536157
MIRT712421	hsa-miR-4725-5p	HITS-CLIP	19536157
MIRT712420	hsa-miR-4252	HITS-CLIP	19536157
MIRT712419	hsa-miR-486-3p	HITS-CLIP	19536157
MIRT712418	hsa-miR-7973	HITS-CLIP	19536157
MIRT712417	hsa-miR-6808-3p	HITS-CLIP	19536157
MIRT712425	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT712424	hsa-miR-4292	HITS-CLIP	19536157
MIRT712423	hsa-miR-6791-5p	HITS-CLIP	19536157
MIRT712422	hsa-miR-6852-5p	HITS-CLIP	19536157
MIRT712421	hsa-miR-4725-5p	HITS-CLIP	19536157
MIRT712420	hsa-miR-4252	HITS-CLIP	19536157
MIRT712419	hsa-miR-486-3p	HITS-CLIP	19536157
MIRT712418	hsa-miR-7973	HITS-CLIP	19536157
MIRT712417	hsa-miR-6808-3p	HITS-CLIP	19536157
MIRT667494	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT667493	hsa-miR-6841-3p	HITS-CLIP	23824327
MIRT667492	hsa-miR-1915-5p	HITS-CLIP	23824327
MIRT667491	hsa-miR-4786-3p	HITS-CLIP	23824327
MIRT667490	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT641748	hsa-miR-618	HITS-CLIP	23824327
MIRT641747	hsa-miR-1470	HITS-CLIP	23824327
MIRT641746	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT641745	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT641744	hsa-miR-486-5p	HITS-CLIP	23824327
MIRT641743	hsa-miR-4469	HITS-CLIP	23824327
MIRT641742	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT641741	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT1125019	hsa-miR-1324	CLIP-seq
MIRT1125020	hsa-miR-3166	CLIP-seq
MIRT1125021	hsa-miR-3614-5p	CLIP-seq
MIRT1125022	hsa-miR-4662a-5p	CLIP-seq
MIRT1125023	hsa-miR-890	CLIP-seq
MIRT1125024	hsa-miR-3121-5p	CLIP-seq
MIRT1125025	hsa-miR-3127-3p	CLIP-seq
MIRT1125026	hsa-miR-3145-3p	CLIP-seq
MIRT1125021	hsa-miR-3614-5p	CLIP-seq
MIRT1125027	hsa-miR-3667-3p	CLIP-seq
MIRT1125028	hsa-miR-4433	CLIP-seq
MIRT1125029	hsa-miR-4459	CLIP-seq
MIRT1125022	hsa-miR-4662a-5p	CLIP-seq
MIRT1125030	hsa-miR-4691-5p	CLIP-seq
MIRT1125031	hsa-miR-4699-5p	CLIP-seq
MIRT1125032	hsa-miR-4753-3p	CLIP-seq
MIRT1125033	hsa-miR-4768-3p	CLIP-seq
MIRT1125034	hsa-miR-7	CLIP-seq
MIRT1125023	hsa-miR-890	CLIP-seq
MIRT1551013	hsa-miR-378g	CLIP-seq
MIRT1551014	hsa-miR-4437	CLIP-seq
MIRT1551015	hsa-miR-4674	CLIP-seq
MIRT1551016	hsa-miR-4731-5p	CLIP-seq
MIRT2035276	hsa-miR-136	CLIP-seq
MIRT2035277	hsa-miR-1972	CLIP-seq
MIRT2035278	hsa-miR-203	CLIP-seq
MIRT2035279	hsa-miR-2277-3p	CLIP-seq
MIRT1125024	hsa-miR-3121-5p	CLIP-seq
MIRT1125025	hsa-miR-3127-3p	CLIP-seq
MIRT2035280	hsa-miR-3607-5p	CLIP-seq
MIRT2035281	hsa-miR-3611	CLIP-seq
MIRT1125027	hsa-miR-3667-3p	CLIP-seq
MIRT2035282	hsa-miR-3668	CLIP-seq
MIRT2035283	hsa-miR-4310	CLIP-seq
MIRT2035284	hsa-miR-4474-5p	CLIP-seq
MIRT1125030	hsa-miR-4691-5p	CLIP-seq
MIRT2035285	hsa-miR-4716-5p	CLIP-seq
MIRT2035286	hsa-miR-4738-3p	CLIP-seq
MIRT2035287	hsa-miR-4749-3p	CLIP-seq
MIRT2035288	hsa-miR-501-5p	CLIP-seq
MIRT2035289	hsa-miR-542-3p	CLIP-seq
MIRT2035290	hsa-miR-548g	CLIP-seq
MIRT2035277	hsa-miR-1972	CLIP-seq
MIRT2035279	hsa-miR-2277-3p	CLIP-seq
MIRT2035283	hsa-miR-4310	CLIP-seq
MIRT2265789	hsa-miR-4642	CLIP-seq
MIRT2035289	hsa-miR-542-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IDA	23474712
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	23474712
GO:0007420	Process	Brain development	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IDA	23474712
GO:0019213	Function	Deacetylase activity	IDA	21257746
GO:0019213	Function	Deacetylase activity	IEA
GO:0042278	Process	Purine nucleoside metabolic process	IBA
GO:0042278	Process	Purine nucleoside metabolic process	IDA	21257746
GO:0042278	Process	Purine nucleoside metabolic process	IEA
GO:0051725	Process	Protein de-ADP-ribosylation	IDA	23474712
GO:0061463	Function	O-acetyl-ADP-ribose deacetylase activity	IEA
GO:0140291	Process	Peptidyl-glutamate ADP-deribosylation	IDA	23474714
GO:0140291	Process	Peptidyl-glutamate ADP-deribosylation	IEA
GO:0140293	Function	ADP-ribosylglutamate hydrolase activity	IBA
GO:0140293	Function	ADP-ribosylglutamate hydrolase activity	IDA	23474714
GO:0140293	Function	ADP-ribosylglutamate hydrolase activity	IEA

Other IDs

• MIM: 611567
• HGNC: 16126
• e!Ensembl: ENSG00000172264

Protein

• UniProt ID: A1Z1Q3
• Protein name: ADP-ribose glycohydrolase MACROD2 (MACRO domain-containing protein 2) (O-acetyl-ADP-ribose deacetylase MACROD2) (EC 3.5.1.-) ([Protein ADP-ribosylaspartate] hydrolase MACROD2) (EC 3.2.2.-) ([Protein ADP-ribosylglutamate] hydrolase MACROD2) (EC 3.2.2.-)
• Protein function: Removes ADP-ribose from aspartate and glutamate residues in proteins bearing a single ADP-ribose moiety (PubMed:23474712, PubMed:23474714). Inactive towards proteins bearing poly-ADP-ribose (PubMed:23474712, PubMed:23474714). Deacetylates O-acet
• PDB: 4IQY, 6Y4Y, 6Y4Z, 6Y73
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01661	Macro	88 → 201	Macro domain	Domain

• Sequence:

  MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQE
  TSQVKKSLTEKVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNL
  NGCDTGHAKITCGYDLPAKYVIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSV
  AFPCISTGIYGFPNEPAAVIALNTIKEWLAKNHHEVDRIIFCVFLEVDFKIYKKKMNEFF
  SVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDADGVNTVTVPGPASEEAVEDCK
  DEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYMETEELSSNQE
  DAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDAGAQDEAKEQ
  RNGTK

• Sequence length: 425

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL ENAMEL HYPOPLASIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EATING DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GRAVES OPHTHALMOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM 21 WITH OR WITHOUT ANOSMIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACROD2-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTINODULAR GOITER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSPOSITION OF THE GREAT ARTERIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	36553611	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	31379025	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	24954375	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	20663923, 32081867, 34069769	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21656903, 31681417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	GWASDB_DG	20663923, 22843504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	GWASCAT_DG	20663923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	20663923		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20663923, 23471985, 23575222, 24204716, 25360606, 25975968, 36150388	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	BEFREE	21656903, 25360606, 30610940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	22182935		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	25422431, 35485697	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	31467233	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24954375	Associate	★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	30804558		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30034629		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26375816		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26375816, 39332629	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	22936669		★☆☆☆☆ Found in Text Mining only
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26857264	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	27304844	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Defects Congenital	Congenital heart defect	Pubtator	33463545	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	33463545	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	34572079	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21626137	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASDB_DG	21626137		★☆☆☆☆ Found in Text Mining only
HYPOGONADOTROPIC HYPOGONADISM 21 WITH OR WITHOUT ANOSMIA	Hypogonadotropic Hypogonadism With Or Without Anosmia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	30619475		★☆☆☆☆ Found in Text Mining only
Kabuki make-up syndrome	Kabuki Syndrome	BEFREE	17586838, 30619475		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	31698100		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	27064257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	35138370	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20331625	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	31467233		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	27064257		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30619475		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30034629		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30619475		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	30619475		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	32427867	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30227424		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30619475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	33624934	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	21656903		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	GWASCAT_DG	30738427		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35398964	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20331625, 26857264	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33191407	Associate	★☆☆☆☆ Found in Text Mining only