CRY1 (cryptochrome circadian regulator 1)

Gene

• Entrez ID: 1407
• Gene name: Cryptochrome circadian regulator 1
• Gene symbol: CRY1
• Synonyms (NCBI Gene): DSPD, PHLL1
• Chromosome: 12
• Chromosome location: 12q23.3
• Summary: This gene encodes a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulatio

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs184039278	T>C,G	Risk-factor	Missense variant, intron variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043195	hsa-miR-324-5p	CLASH	23622248
MIRT911078	hsa-miR-299-5p	CLIP-seq
MIRT911079	hsa-miR-3120-5p	CLIP-seq
MIRT911080	hsa-miR-3152-3p	CLIP-seq
MIRT911081	hsa-miR-3973	CLIP-seq
MIRT911082	hsa-miR-499-3p	CLIP-seq
MIRT911083	hsa-miR-499a-3p	CLIP-seq
MIRT911084	hsa-miR-520g	CLIP-seq
MIRT911085	hsa-miR-520h	CLIP-seq
MIRT911086	hsa-miR-561	CLIP-seq
MIRT1970117	hsa-miR-3545-3p	CLIP-seq
MIRT1970118	hsa-miR-4286	CLIP-seq
MIRT1970119	hsa-miR-4680-5p	CLIP-seq
MIRT1970120	hsa-miR-548l	CLIP-seq
MIRT1970121	hsa-miR-548n	CLIP-seq
MIRT2206057	hsa-miR-193a-5p	CLIP-seq
MIRT911078	hsa-miR-299-5p	CLIP-seq
MIRT2206058	hsa-miR-3692	CLIP-seq
MIRT2386489	hsa-miR-1207-3p	CLIP-seq
MIRT2386490	hsa-miR-144	CLIP-seq
MIRT2206057	hsa-miR-193a-5p	CLIP-seq
MIRT2206058	hsa-miR-3692	CLIP-seq
MIRT2386491	hsa-miR-4709-5p	CLIP-seq
MIRT2386492	hsa-miR-4772-3p	CLIP-seq
MIRT2509223	hsa-miR-1284	CLIP-seq
MIRT2509224	hsa-miR-1323	CLIP-seq
MIRT2206057	hsa-miR-193a-5p	CLIP-seq
MIRT2509225	hsa-miR-3074-3p	CLIP-seq
MIRT2509226	hsa-miR-3613-3p	CLIP-seq
MIRT2509227	hsa-miR-361-5p	CLIP-seq
MIRT2509228	hsa-miR-4796-5p	CLIP-seq
MIRT2509229	hsa-miR-548o	CLIP-seq
MIRT2509230	hsa-miR-616	CLIP-seq
MIRT2509231	hsa-miR-617	CLIP-seq
MIRT2509224	hsa-miR-1323	CLIP-seq
MIRT2509225	hsa-miR-3074-3p	CLIP-seq
MIRT2509227	hsa-miR-361-5p	CLIP-seq
MIRT2509229	hsa-miR-548o	CLIP-seq
MIRT2509231	hsa-miR-617	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARNTL	Activation	22750052
ARNTL	Unknown	17660446
CLOCK	Activation	22750052
CLOCK	Unknown	17660446
NPAS2	Unknown	17660446

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	12397359, 14672706, 15147242
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	TAS	9801304
GO:0003690	Function	Double-stranded DNA binding	IDA	9801304
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003904	Function	Deoxyribodipyrimidine photo-lyase activity	IDA	8909283
GO:0003914	Function	DNA (6-4) photolyase activity	IDA	8909283
GO:0005515	Function	Protein binding	IPI	9383998, 17463251, 20852621, 21613214, 21680841, 23133559, 26431207, 28514442, 30530698, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26431207
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	ISS
GO:0006111	Process	Regulation of gluconeogenesis	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0007623	Process	Circadian rhythm	ISS
GO:0009416	Process	Response to light stimulus	IEA
GO:0009416	Process	Response to light stimulus	ISS
GO:0009785	Process	Blue light signaling pathway	NAS	8909283
GO:0009881	Function	Photoreceptor activity	IEA
GO:0009882	Function	Blue light photoreceptor activity	NAS	8909283
GO:0014823	Process	Response to activity	IEA
GO:0014823	Process	Response to activity	ISS
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	22170608
GO:0019900	Function	Kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019902	Function	Phosphatase binding	IEA
GO:0019902	Function	Phosphatase binding	IPI	9383998
GO:0019915	Process	Lipid storage	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	ISS
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS
GO:0032868	Process	Response to insulin	IEA
GO:0032922	Process	Circadian regulation of gene expression	IBA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0033762	Process	Response to glucagon	IEA
GO:0033762	Process	Response to glucagon	ISS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0042754	Process	Negative regulation of circadian rhythm	IEA
GO:0042754	Process	Negative regulation of circadian rhythm	ISS
GO:0042770	Process	Signal transduction in response to DNA damage	IEA
GO:0042770	Process	Signal transduction in response to DNA damage	ISS
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IBA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12397359, 23133559
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0070888	Function	E-box binding	IEA
GO:0071949	Function	FAD binding	IBA
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	ISS
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	IEA
GO:2000323	Process	Negative regulation of nuclear receptor-mediated glucocorticoid signaling pathway	ISS
GO:2000850	Process	Negative regulation of glucocorticoid secretion	IEA

Other IDs

• MIM: 601933
• HGNC: 2384
• e!Ensembl: ENSG00000008405

Protein

• UniProt ID: Q16526
• Protein name: Cryptochrome-1
• Protein function: Transcriptional repressor which forms a core component of the circadian clock. The circadian clock, an internal time-keeping system, regulates various physiological processes through the generation of approximately 24 hour circadian rhythms in g
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00875	DNA_photolyase	5 → 170	DNA photolyase	Domain
  PF03441	FAD_binding_7	286 → 486	FAD binding domain of DNA photolyase	Domain

• Sequence:

  MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
  DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
  GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
  PLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMN
  ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
  TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
  VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
  RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
  IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGFMGYSAENIPGCSSSGSCSQGSGILHYA
  HGDSQQTHLLKQGRSSMGTGLSGGKRPSQEEDTQSIGPKVQRQSTN

• Sequence length: 586

Pathways

KEGG:

Circadian rhythm

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention deficit hyperactivity disorder	association; risk factor	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	association; risk factor; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRY1-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELAYED SLEEP PHASE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Delayed sleep phase syndrome, susceptibility to	Uncertain significance; association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance; association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	association; risk factor; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	association; risk factor; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	association; risk factor; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	association; risk factor; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP DISORDERS, CIRCADIAN RHYTHM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep-wake schedule disorder, delayed phase type	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	association; risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Advanced Sleep Phase Syndrome	Advanced Sleep Phase Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	35365695, 38102312	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23951166		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	35365695	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26218278		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	35000095	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26218278		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	40441253	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	31708917	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	30758328, 32538895	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30758328		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	19181792		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15722957, 20072116		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	15722957, 20072116, 22538398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	21781277	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	20978934, 23725643, 29455641		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29958276, 39193850	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34697063	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29455641		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18720043	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18720043		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	25391456		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34610814, 36324080, 37580741	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30241461		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19181792, 19500131, 22470559		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	29940771		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35116071	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23626715, 26768731, 29940771, 29953268		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23626715, 26768731, 27492458	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29940771		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	22975484, 30235329		★☆☆☆☆ Found in Text Mining only
Delayed Sleep Phase Syndrome	Delayed Sleep Phase Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20072116, 23138696, 33809270	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	22538398, 23138696, 27721187		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22538398, 23138696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	24581835	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24548145		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24548145		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24548145	Associate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic Dysplasia	BEFREE	28249777		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28731140		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16683245		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18720043		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32503923	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26337663	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24135790	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23317246		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23317246	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30241461		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	26131842	Associate	★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	28863887, 29874863		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	27412556, 29937374		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20023637, 21286865, 25391456, 28863887		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30235329	Associate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	35000095	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	35000095	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24548145	Associate	★☆☆☆☆ Found in Text Mining only
Keratosis Follicularis	Keratosis Follicularis	BEFREE	28249777		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25344870		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35575281	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23626715	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18720043	Inhibit	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20072116, 24581835, 29128257		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20978934, 23725643, 29455641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29455641		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25798752		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19934327, 25388799		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18720043, 22080729, 22470559		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23242607		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	23138696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23138696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	BEFREE	25391456		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25391456, 30174302		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	20072116		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis II	Mucopolysaccharidosis	Pubtator	24083598	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	CTD_human_DG	16999817		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18720043, 21628572, 22080729, 23242607, 23626715, 24099911, 29940771, 29953268		★☆☆☆☆ Found in Text Mining only
Non-24 Hour Sleep-Wake Disorder	Non-24 Hour Sleep-Wake Disorder	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Nonorganic Sleep Wake Cycle Disorders	Nonorganic Sleep Wake Cycle Disorders	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26923944, 30174302		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31613643, 34610814, 36324080, 36497566, 37580741	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	35276838	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30026846		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18720043	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25798752		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29353016, 31292011		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	23254314		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	30815822		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22470559		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19934327, 25388799		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19934327, 21846818, 25388799, 33452241	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25905433	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17376600		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	17376600		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	22538398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	22538398		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Shift-Work Sleep Disorder	Shift-Work Sleep Disorder	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30235329	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	39940739	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29164122, 30235329		★☆☆☆☆ Found in Text Mining only
Sleep Disorders Circadian Rhythm	Sleep disorder	Pubtator	28388406, 32538895	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22081375	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24708606	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34162762	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32349365	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20072116, 24581835		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33650658	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34697063	Associate	★☆☆☆☆ Found in Text Mining only