CTCFL (CCCTC-binding factor like)

Gene

• Entrez ID: 140690
• Gene name: CCCTC-binding factor like
• Gene symbol: CTCFL
• Synonyms (NCBI Gene): BORIS, CT27, CTCF-T, HMGB1L1, dJ579F20.2
• Chromosome: 20
• Chromosome location: 20q13.31
• Summary: CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT624913	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT624912	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT624911	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT624910	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT624909	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT624908	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT624907	hsa-miR-1976	HITS-CLIP	23824327
MIRT624906	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT624905	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT624903	hsa-miR-4326	HITS-CLIP	23824327
MIRT624904	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT624913	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT624912	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT624911	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT624910	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT624909	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT624908	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT624907	hsa-miR-1976	HITS-CLIP	23824327
MIRT624906	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT624905	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT630980	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT624903	hsa-miR-4326	HITS-CLIP	23824327
MIRT624904	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT629165	hsa-miR-548a-5p	HITS-CLIP	23824327
MIRT629164	hsa-miR-548ab	HITS-CLIP	23824327
MIRT629163	hsa-miR-548ad-5p	HITS-CLIP	23824327
MIRT629162	hsa-miR-548ae-5p	HITS-CLIP	23824327
MIRT629161	hsa-miR-548ak	HITS-CLIP	23824327
MIRT629160	hsa-miR-548am-5p	HITS-CLIP	23824327
MIRT629159	hsa-miR-548ap-5p	HITS-CLIP	23824327
MIRT629158	hsa-miR-548aq-5p	HITS-CLIP	23824327
MIRT629157	hsa-miR-548ar-5p	HITS-CLIP	23824327
MIRT629156	hsa-miR-548as-5p	HITS-CLIP	23824327
MIRT629155	hsa-miR-548au-5p	HITS-CLIP	23824327
MIRT629154	hsa-miR-548ay-5p	HITS-CLIP	23824327
MIRT629153	hsa-miR-548b-5p	HITS-CLIP	23824327
MIRT629152	hsa-miR-548bb-5p	HITS-CLIP	23824327
MIRT629151	hsa-miR-548c-5p	HITS-CLIP	23824327
MIRT629150	hsa-miR-548d-5p	HITS-CLIP	23824327
MIRT629149	hsa-miR-548h-5p	HITS-CLIP	23824327
MIRT629148	hsa-miR-548i	HITS-CLIP	23824327
MIRT629147	hsa-miR-548j-5p	HITS-CLIP	23824327
MIRT629146	hsa-miR-548o-5p	HITS-CLIP	23824327
MIRT629145	hsa-miR-548w	HITS-CLIP	23824327
MIRT629144	hsa-miR-548y	HITS-CLIP	23824327
MIRT629143	hsa-miR-559	HITS-CLIP	23824327
MIRT629142	hsa-miR-548av-5p	HITS-CLIP	23824327
MIRT629141	hsa-miR-548k	HITS-CLIP	23824327
MIRT629139	hsa-miR-8054	HITS-CLIP	23824327
MIRT629140	hsa-miR-548l	HITS-CLIP	23824327
MIRT629138	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT629137	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT629136	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT629135	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT629134	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT629133	hsa-miR-5096	HITS-CLIP	23824327
MIRT624913	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT624912	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT624911	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT624910	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT624909	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT624908	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT624907	hsa-miR-1976	HITS-CLIP	23824327
MIRT624906	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT624905	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT624904	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT624903	hsa-miR-4326	HITS-CLIP	23824327
MIRT624913	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT624912	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT624911	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT624910	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT624909	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT624908	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT624907	hsa-miR-1976	HITS-CLIP	23824327
MIRT624906	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT624905	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT624903	hsa-miR-4326	HITS-CLIP	23824327
MIRT624904	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT624913	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT624912	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT624911	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT624910	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT624909	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT624908	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT624907	hsa-miR-1976	HITS-CLIP	23824327
MIRT624906	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT624905	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT630980	hsa-miR-891a-3p	HITS-CLIP	23824327
MIRT624903	hsa-miR-4326	HITS-CLIP	23824327
MIRT624904	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT629165	hsa-miR-548a-5p	HITS-CLIP	23824327
MIRT629164	hsa-miR-548ab	HITS-CLIP	23824327
MIRT629163	hsa-miR-548ad-5p	HITS-CLIP	23824327
MIRT629162	hsa-miR-548ae-5p	HITS-CLIP	23824327
MIRT629161	hsa-miR-548ak	HITS-CLIP	23824327
MIRT629160	hsa-miR-548am-5p	HITS-CLIP	23824327
MIRT629159	hsa-miR-548ap-5p	HITS-CLIP	23824327
MIRT629158	hsa-miR-548aq-5p	HITS-CLIP	23824327
MIRT629157	hsa-miR-548ar-5p	HITS-CLIP	23824327
MIRT629156	hsa-miR-548as-5p	HITS-CLIP	23824327
MIRT629155	hsa-miR-548au-5p	HITS-CLIP	23824327
MIRT629154	hsa-miR-548ay-5p	HITS-CLIP	23824327
MIRT629153	hsa-miR-548b-5p	HITS-CLIP	23824327
MIRT629152	hsa-miR-548bb-5p	HITS-CLIP	23824327
MIRT629151	hsa-miR-548c-5p	HITS-CLIP	23824327
MIRT629150	hsa-miR-548d-5p	HITS-CLIP	23824327
MIRT629149	hsa-miR-548h-5p	HITS-CLIP	23824327
MIRT629148	hsa-miR-548i	HITS-CLIP	23824327
MIRT629147	hsa-miR-548j-5p	HITS-CLIP	23824327
MIRT629146	hsa-miR-548o-5p	HITS-CLIP	23824327
MIRT629145	hsa-miR-548w	HITS-CLIP	23824327
MIRT629144	hsa-miR-548y	HITS-CLIP	23824327
MIRT629143	hsa-miR-559	HITS-CLIP	23824327
MIRT629142	hsa-miR-548av-5p	HITS-CLIP	23824327
MIRT629141	hsa-miR-548k	HITS-CLIP	23824327
MIRT629139	hsa-miR-8054	HITS-CLIP	23824327
MIRT629140	hsa-miR-548l	HITS-CLIP	23824327
MIRT629138	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT629137	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT629136	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT629135	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT629134	hsa-miR-197-3p	HITS-CLIP	23824327
MIRT629133	hsa-miR-5096	HITS-CLIP	23824327
MIRT624913	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT624912	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT624911	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT624910	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT624909	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT624908	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT624907	hsa-miR-1976	HITS-CLIP	23824327
MIRT624906	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT624905	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT624904	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT624903	hsa-miR-4326	HITS-CLIP	23824327
MIRT913994	hsa-miR-1236	CLIP-seq
MIRT913995	hsa-miR-3074-5p	CLIP-seq
MIRT913996	hsa-miR-3153	CLIP-seq
MIRT913997	hsa-miR-3647-3p	CLIP-seq
MIRT913998	hsa-miR-3674	CLIP-seq
MIRT913999	hsa-miR-370	CLIP-seq
MIRT914000	hsa-miR-4524	CLIP-seq
MIRT914001	hsa-miR-4646-5p	CLIP-seq
MIRT914002	hsa-miR-4651	CLIP-seq
MIRT914003	hsa-miR-4668-5p	CLIP-seq
MIRT914004	hsa-miR-4731-5p	CLIP-seq
MIRT914005	hsa-miR-4760-3p	CLIP-seq
MIRT914006	hsa-miR-513a-3p	CLIP-seq
MIRT914007	hsa-miR-545	CLIP-seq
MIRT914008	hsa-miR-548p	CLIP-seq
MIRT914009	hsa-miR-579	CLIP-seq
MIRT914010	hsa-miR-608	CLIP-seq
MIRT914011	hsa-miR-664	CLIP-seq
MIRT914012	hsa-miR-885-3p	CLIP-seq
MIRT914013	hsa-miR-944	CLIP-seq
MIRT2206782	hsa-miR-485-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18413740
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16140944
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16140944
GO:0003677	Function	DNA binding	IDA	18413740
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	18765639
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005694	Component	Chromosome	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010557	Process	Positive regulation of macromolecule biosynthetic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	18413740
GO:0016604	Component	Nuclear body	IDA
GO:0034502	Process	Protein localization to chromosome	IEA
GO:0040029	Process	Epigenetic regulation of gene expression	IEA
GO:0042393	Function	Histone binding	IEA
GO:0042393	Function	Histone binding	ISS
GO:0043035	Function	Chromatin insulator sequence binding	IBA
GO:0043565	Function	Sequence-specific DNA binding	IDA	18765639
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	IMP	18765639
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	18413740
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16140944
GO:0046872	Function	Metal ion binding	IEA
GO:0071169	Process	Establishment of protein localization to chromatin	IMP	18765639
GO:0071514	Process	Genomic imprinting	IEA
GO:0071514	Process	Genomic imprinting	ISS

Other IDs

• MIM: 607022
• HGNC: 16234
• e!Ensembl: ENSG00000124092

Protein

• UniProt ID: Q8NI51
• Protein name: Transcriptional repressor CTCFL (Brother of the regulator of imprinted sites) (CCCTC-binding factor) (CTCF paralog) (CTCF-like protein) (Cancer/testis antigen 27) (CT27) (Zinc finger protein CTCF-T)
• Protein function: Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	313 → 336	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	428 → 451	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	546 → 567	Zinc finger, C2H2 type	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis specific. Specifically expressed in primary spermatocytes.
• Sequence:

  MAATEISVLSEQFTKIKELELMPEKGLKEEEKDGVCREKDHRSPSELEAERTSGAFQDSV
  LEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLL
  WLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVSLAETTGLI
  KLEEEQEKNQLLAERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEK
  AKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKTFRTVTLL
  RNHVNTHTGTRPYKCNDCNMAFVTSGELVRHRRYKHTHEKPFKCSMCKYASVEASKLKRH
  VRSHTGERPFQCCQCSYASRDTYKLKRHMRTHSGEKPYECHICHTRFTQSGTMKIHILQK
  HGENVPKYQCPHCATIIARKSDLRVHMRNLHAYSAAELKCRYCSAVFHERYALIQHQKTH
  KNEKRFKCKHCSYACKQERHMTAHIRTHTGEKPFTCLSCNKCFRQKQLLNAHFRKYHDAN
  FIPTVYKCSKCGKGFSRWINLHRHSEKCGSGEAKSAASGKGRRTRKRKQTILKEATKGQK
  EAAKGWKEAANGDEAAAEEASTTKGEQFPGEMFPVACRETTARVKEEVDEGVTCEMLLNT
  MDK

• Sequence length: 663

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24393203		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24393203		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18195709, 18355444, 21034534, 24983365, 27219508, 29212169, 30390146, 30498011		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	27219508	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18195709, 21034534, 23019417, 24983365, 26185996, 27219508, 30498011, 37235839	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20305816, 20876690	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16140944, 16854382		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26185996	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	24658009	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23237599, 28328845	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16854382		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21325284, 21558405, 22792300, 27416782, 27840277		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	18095639, 21296871, 23390377	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21296871, 31406110, 31516605		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24393203		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29181107		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22223638, 26185996	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29181107		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24204606	Associate	★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	18467432		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17363524, 24658009, 27618037		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	24658009	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24658009, 27618037	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21296871, 31516605		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22676270		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22676270		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	19956589		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	24023969		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23592437		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23592437	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23592437		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	31675998	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	26496499	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	26185996	Associate	★☆☆☆☆ Found in Text Mining only
Infantile hemangioma	Hemangioma	BEFREE	26496499		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24563233	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	24563233		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28498449		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23237599, 28645561		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16140944		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21325284, 27416782	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21558405	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31033702		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18195709, 18355444, 21034534, 24983365, 27219508, 29212169, 30390146, 30498011		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	24658009		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22676270		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19305507, 21325284, 21558405, 22792300, 27416782, 27840277		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	21296871, 31406110		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21495859		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	21558405, 23237599, 25279549, 30498011		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12191639, 16854382, 17182597, 17363524, 17962299, 18355444, 19305507, 21079786, 21296871, 21495859, 21811597, 22168535, 22676270, 23237599, 24657531, 24928684, 25279549, 26496499, 27416782, 28104398, 28645561, 29077515, 29088719, 29860503, 30323717, 30390146, 31391581, 31406110		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29181107		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18195709		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	17957795		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17957795		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	25499215		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15084242, 18355444, 18632606, 21874228, 22019212, 23237599, 24563233, 24658009, 25279549, 25499215, 26496499, 27219508, 27618037, 30390146		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28104398		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31614113	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18095639		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	21296871, 31406110		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18095639, 20649179, 20876690, 21296871, 23390377, 31292201, 35132075, 37026005	Associate	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	24984200		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25499215	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	34199176	Associate	★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	19675668		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30212590		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24563233		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22676270		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24563233	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19305507		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21495859		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34721660	Associate	★☆☆☆☆ Found in Text Mining only
Strawberry nevus of skin	Strawberry Nevus Of Skin	BEFREE	26496499		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	21558405, 22792300	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	17363524		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	LHGDN	17363524		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34199176	Associate	★☆☆☆☆ Found in Text Mining only