Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	140545
Gene name	Ring finger protein 32
Gene symbol	RNF32
Synonyms (NCBI Gene)	FKSG33HSD15LMBR2
Chromosome	7
Chromosome location	7q36.3
Summary	The protein encoded by this gene contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be exp

Show/Hide all (7)

miRTarBase ID	miRNA	Experiments
MIRT1312521	hsa-miR-3120-3p	CLIP-seq
MIRT1312522	hsa-miR-3941	CLIP-seq
MIRT1312523	hsa-miR-466	CLIP-seq
MIRT1312524	hsa-miR-4672	CLIP-seq
MIRT1312525	hsa-miR-513a-3p	CLIP-seq
MIRT1312526	hsa-miR-556-3p	CLIP-seq
MIRT1312527	hsa-miR-944	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21163940, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016235	Component	Aggresome	IDA	11890671
GO:0016604	Component	Nuclear body	IDA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
610241	17118	ENSG00000105982

Q9H0A6

Protein name

RING finger protein 32

Protein function

May play a role in sperm formation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13639	zf-RING_2	125 → 169	Ring finger domain	Domain
PF00612	IQ	187 → 207	IQ calmodulin-binding motif	Motif
PF13445	zf-RING_UBOX	293 → 362	RING-type zinc-finger	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in testis, less abundant in ovary. {ECO:0000269|PubMed:11890671}.

Sequence

MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAII
DTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQ
GDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHD
GARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLRKKFFEKKFTEISHRILCSY
NTNIEELFAEIDQCLAINRSVLQQLEEKCGHEITEEEWEKIQVQALRRETHECSICLAPL
SAAGGQRVGAGRRSREMALLSCSHVFHHACLLALEEFSVGDRPPFHACPLCRSCYQKKIL
EC

Sequence length

362

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Barrett Esophagus	Barrett esophagus	BEFREE	25228972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	25228972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38270646	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25228972	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RNF32 (ring finger protein 32)