Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	140290
Gene name	T-complex 10 like
Gene symbol	TCP10L
Synonyms (NCBI Gene)	C21orf77LINC00846PRED77TCP10A-1TCP10A-2
Chromosome	21
Chromosome location	21q22.11

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments
MIRT1416659	hsa-miR-1178	CLIP-seq
MIRT1416660	hsa-miR-127-5p	CLIP-seq
MIRT1416661	hsa-miR-128	CLIP-seq
MIRT1416662	hsa-miR-1289	CLIP-seq
MIRT1416663	hsa-miR-1291	CLIP-seq
MIRT1416664	hsa-miR-1294	CLIP-seq
MIRT1416665	hsa-miR-2467-3p	CLIP-seq
MIRT1416666	hsa-miR-27a	CLIP-seq
MIRT1416667	hsa-miR-27b	CLIP-seq
MIRT1416668	hsa-miR-3199	CLIP-seq
MIRT1416669	hsa-miR-328	CLIP-seq
MIRT1416670	hsa-miR-3616-3p	CLIP-seq
MIRT1416671	hsa-miR-3678-3p	CLIP-seq
MIRT1416672	hsa-miR-4316	CLIP-seq
MIRT1416673	hsa-miR-4514	CLIP-seq
MIRT1416674	hsa-miR-4645-5p	CLIP-seq
MIRT1416675	hsa-miR-4652-5p	CLIP-seq
MIRT1416676	hsa-miR-4673	CLIP-seq
MIRT1416677	hsa-miR-4677-3p	CLIP-seq
MIRT1416678	hsa-miR-4690-3p	CLIP-seq
MIRT1416679	hsa-miR-4692	CLIP-seq
MIRT1416680	hsa-miR-4721	CLIP-seq
MIRT1416681	hsa-miR-4755-3p	CLIP-seq
MIRT1416682	hsa-miR-764	CLIP-seq
MIRT1416683	hsa-miR-767-3p	CLIP-seq
MIRT1416664	hsa-miR-1294	CLIP-seq
MIRT1416665	hsa-miR-2467-3p	CLIP-seq
MIRT1416668	hsa-miR-3199	CLIP-seq
MIRT1416670	hsa-miR-3616-3p	CLIP-seq
MIRT2124941	hsa-miR-3664-3p	CLIP-seq
MIRT1416671	hsa-miR-3678-3p	CLIP-seq
MIRT2124942	hsa-miR-4254	CLIP-seq
MIRT1416672	hsa-miR-4316	CLIP-seq
MIRT1416675	hsa-miR-4652-5p	CLIP-seq
MIRT1416677	hsa-miR-4677-3p	CLIP-seq
MIRT1416680	hsa-miR-4721	CLIP-seq
MIRT2124943	hsa-miR-486-3p	CLIP-seq
MIRT2124944	hsa-miR-519a	CLIP-seq
MIRT2124945	hsa-miR-519b-3p	CLIP-seq
MIRT2124946	hsa-miR-519c-3p	CLIP-seq
MIRT2124947	hsa-miR-661	CLIP-seq
MIRT1416660	hsa-miR-127-5p	CLIP-seq
MIRT2124942	hsa-miR-4254	CLIP-seq
MIRT2395609	hsa-miR-4292	CLIP-seq
MIRT2395610	hsa-miR-4308	CLIP-seq
MIRT2395611	hsa-miR-4457	CLIP-seq
MIRT2395612	hsa-miR-513b	CLIP-seq
MIRT2395613	hsa-miR-624	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	14586771
GO:0003714	Function	Transcription corepressor activity	IDA	14586771
GO:0005515	Function	Protein binding	IPI	15469726, 15910542, 21988832, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IDA	14586771
GO:0005634	Component	Nucleus	IEA
GO:0042802	Function	Identical protein binding	IPI	17377852
GO:0140297	Function	DNA-binding transcription factor binding	IDA	15469726

MIM	HGNC	e!Ensembl
608365	11657	ENSG00000242220

Q8TDR4

Protein name

T-complex protein 10A homolog 1 (T-complex protein 10A-1) (TCP10A-1) (TCP10-like)

Protein function

May be involved in transcriptional regulation. Has in vitro transcription inhibition activity. Acts as a tumor suppressor in hepatocellular carcinoma (HCC) cells.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver and testis. Expressed in the seminiferous tubules (at protein level). {ECO:0000269|PubMed:14586771, ECO:0000269|PubMed:15910542}.

Sequence

MLAGQLEARDPKEGTHPEDPCPGAGAVMEKTAVAAEVLTEDCNTGEMPPLQQQIIRLHQE
LGRQKSLWADVHGKLRSHIDALREQNMELREKLRALQLQRWKARKKSAASPHAGQESHTL
ALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSSSNNSAPPKPMSLKIERISSWKT
PPQENRDKNLSRRRQDRRATPTGRPTPCAERRGGV

Sequence length

215

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GASTRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS VIRUS-RELATED HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	31671693	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28803425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26698869, 32438969	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28803425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24565846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24565846		★★★★★ ★☆☆☆☆ Found in Text Mining only

TCP10L (t-complex 10 like)