Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1400
Gene name	Collapsin response mediator protein 1
Gene symbol	CRMP1
Synonyms (NCBI Gene)	CRMP-1DPYSL1DRP-1DRP1ULIP-3
Chromosome	4
Chromosome location	4p16.2
Summary	This gene encodes a member of a family of cytosolic phosphoproteins expressed exclusively in the nervous system. The encoded protein is thought to be a part of the semaphorin signal transduction pathway implicated in semaphorin-induced growth cone collaps

170

Show/Hide all (170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT569829	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT569828	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT569827	hsa-miR-151b	PAR-CLIP	20371350
MIRT569826	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT569825	hsa-miR-4784	PAR-CLIP	20371350
MIRT569824	hsa-miR-4434	PAR-CLIP	20371350
MIRT569823	hsa-miR-4516	PAR-CLIP	20371350
MIRT569822	hsa-miR-5703	PAR-CLIP	20371350
MIRT569821	hsa-miR-765	PAR-CLIP	20371350
MIRT569819	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569820	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569818	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT569817	hsa-miR-5698	PAR-CLIP	20371350
MIRT569816	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT569815	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT569814	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT569829	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT569828	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT569827	hsa-miR-151b	PAR-CLIP	20371350
MIRT569826	hsa-miR-3150b-3p	PAR-CLIP	20371350
MIRT569825	hsa-miR-4784	PAR-CLIP	20371350
MIRT569824	hsa-miR-4434	PAR-CLIP	20371350
MIRT569823	hsa-miR-4516	PAR-CLIP	20371350
MIRT569822	hsa-miR-5703	PAR-CLIP	20371350
MIRT569821	hsa-miR-765	PAR-CLIP	20371350
MIRT569819	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569820	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569818	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT569817	hsa-miR-5698	PAR-CLIP	20371350
MIRT569816	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT569815	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT569814	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT910372	hsa-miR-1208	CLIP-seq
MIRT910373	hsa-miR-1265	CLIP-seq
MIRT910374	hsa-miR-141	CLIP-seq
MIRT910375	hsa-miR-1909	CLIP-seq
MIRT910376	hsa-miR-1972	CLIP-seq
MIRT910377	hsa-miR-200a	CLIP-seq
MIRT910378	hsa-miR-30a	CLIP-seq
MIRT910379	hsa-miR-30b	CLIP-seq
MIRT910380	hsa-miR-30c	CLIP-seq
MIRT910381	hsa-miR-30d	CLIP-seq
MIRT910382	hsa-miR-30e	CLIP-seq
MIRT910383	hsa-miR-3190	CLIP-seq
MIRT910384	hsa-miR-3202	CLIP-seq
MIRT910385	hsa-miR-3660	CLIP-seq
MIRT910386	hsa-miR-412	CLIP-seq
MIRT910387	hsa-miR-4256	CLIP-seq
MIRT910388	hsa-miR-4420	CLIP-seq
MIRT910389	hsa-miR-4475	CLIP-seq
MIRT910390	hsa-miR-4491	CLIP-seq
MIRT910391	hsa-miR-4526	CLIP-seq
MIRT910392	hsa-miR-4533	CLIP-seq
MIRT910393	hsa-miR-4650-5p	CLIP-seq
MIRT910394	hsa-miR-4657	CLIP-seq
MIRT910395	hsa-miR-4688	CLIP-seq
MIRT910396	hsa-miR-4717-5p	CLIP-seq
MIRT910397	hsa-miR-4762-3p	CLIP-seq
MIRT910398	hsa-miR-4764-5p	CLIP-seq
MIRT910399	hsa-miR-4795-5p	CLIP-seq
MIRT910400	hsa-miR-486-3p	CLIP-seq
MIRT910401	hsa-miR-510	CLIP-seq
MIRT910402	hsa-miR-642b	CLIP-seq
MIRT1969889	hsa-miR-4318	CLIP-seq
MIRT910385	hsa-miR-3660	CLIP-seq
MIRT910386	hsa-miR-412	CLIP-seq
MIRT910391	hsa-miR-4526	CLIP-seq
MIRT910373	hsa-miR-1265	CLIP-seq
MIRT2447658	hsa-miR-130a	CLIP-seq
MIRT2447659	hsa-miR-130b	CLIP-seq
MIRT2447660	hsa-miR-139-5p	CLIP-seq
MIRT2447661	hsa-miR-153	CLIP-seq
MIRT910375	hsa-miR-1909	CLIP-seq
MIRT910376	hsa-miR-1972	CLIP-seq
MIRT2447662	hsa-miR-19a	CLIP-seq
MIRT2447663	hsa-miR-19b	CLIP-seq
MIRT2447664	hsa-miR-2276	CLIP-seq
MIRT2447665	hsa-miR-301a	CLIP-seq
MIRT2447666	hsa-miR-301b	CLIP-seq
MIRT2447667	hsa-miR-3126-5p	CLIP-seq
MIRT2447668	hsa-miR-331-3p	CLIP-seq
MIRT2447669	hsa-miR-3605-5p	CLIP-seq
MIRT2447670	hsa-miR-3666	CLIP-seq
MIRT2447671	hsa-miR-3943	CLIP-seq
MIRT2447672	hsa-miR-4257	CLIP-seq
MIRT2447673	hsa-miR-4295	CLIP-seq
MIRT2447674	hsa-miR-448	CLIP-seq
MIRT910390	hsa-miR-4491	CLIP-seq
MIRT2447675	hsa-miR-454	CLIP-seq
MIRT910393	hsa-miR-4650-5p	CLIP-seq
MIRT910394	hsa-miR-4657	CLIP-seq
MIRT2447676	hsa-miR-4671-3p	CLIP-seq
MIRT910395	hsa-miR-4688	CLIP-seq
MIRT2447677	hsa-miR-4690-3p	CLIP-seq
MIRT2447678	hsa-miR-4708-3p	CLIP-seq
MIRT2447679	hsa-miR-4711-5p	CLIP-seq
MIRT2447680	hsa-miR-4714-3p	CLIP-seq
MIRT910396	hsa-miR-4717-5p	CLIP-seq
MIRT2447681	hsa-miR-4722-3p	CLIP-seq
MIRT910398	hsa-miR-4764-5p	CLIP-seq
MIRT2447682	hsa-miR-4769-3p	CLIP-seq
MIRT2447683	hsa-miR-4772-3p	CLIP-seq
MIRT2447684	hsa-miR-4773	CLIP-seq
MIRT910400	hsa-miR-486-3p	CLIP-seq
MIRT2447685	hsa-miR-499a-5p	CLIP-seq
MIRT910401	hsa-miR-510	CLIP-seq
MIRT910402	hsa-miR-642b	CLIP-seq
MIRT2447686	hsa-miR-802	CLIP-seq
MIRT2447687	hsa-miR-942	CLIP-seq
MIRT2447667	hsa-miR-3126-5p	CLIP-seq
MIRT2447672	hsa-miR-4257	CLIP-seq
MIRT910373	hsa-miR-1265	CLIP-seq
MIRT2447658	hsa-miR-130a	CLIP-seq
MIRT2447659	hsa-miR-130b	CLIP-seq
MIRT2447664	hsa-miR-2276	CLIP-seq
MIRT2447665	hsa-miR-301a	CLIP-seq
MIRT2447666	hsa-miR-301b	CLIP-seq
MIRT2447668	hsa-miR-331-3p	CLIP-seq
MIRT2509137	hsa-miR-342-3p	CLIP-seq
MIRT2447669	hsa-miR-3605-5p	CLIP-seq
MIRT2447670	hsa-miR-3666	CLIP-seq
MIRT2447673	hsa-miR-4295	CLIP-seq
MIRT910390	hsa-miR-4491	CLIP-seq
MIRT2447675	hsa-miR-454	CLIP-seq
MIRT910394	hsa-miR-4657	CLIP-seq
MIRT2447676	hsa-miR-4671-3p	CLIP-seq
MIRT2509138	hsa-miR-4695-3p	CLIP-seq
MIRT2447678	hsa-miR-4708-3p	CLIP-seq
MIRT2447680	hsa-miR-4714-3p	CLIP-seq
MIRT2447681	hsa-miR-4722-3p	CLIP-seq
MIRT910398	hsa-miR-4764-5p	CLIP-seq
MIRT2447682	hsa-miR-4769-3p	CLIP-seq
MIRT2447683	hsa-miR-4772-3p	CLIP-seq
MIRT2509139	hsa-miR-513a-5p	CLIP-seq
MIRT2509140	hsa-miR-552	CLIP-seq
MIRT910402	hsa-miR-642b	CLIP-seq
MIRT2447687	hsa-miR-942	CLIP-seq
MIRT910373	hsa-miR-1265	CLIP-seq
MIRT2447658	hsa-miR-130a	CLIP-seq
MIRT2447659	hsa-miR-130b	CLIP-seq
MIRT910375	hsa-miR-1909	CLIP-seq
MIRT910376	hsa-miR-1972	CLIP-seq
MIRT2447664	hsa-miR-2276	CLIP-seq
MIRT2447665	hsa-miR-301a	CLIP-seq
MIRT2447666	hsa-miR-301b	CLIP-seq
MIRT2447667	hsa-miR-3126-5p	CLIP-seq
MIRT2447668	hsa-miR-331-3p	CLIP-seq
MIRT2447669	hsa-miR-3605-5p	CLIP-seq
MIRT2447670	hsa-miR-3666	CLIP-seq
MIRT2447671	hsa-miR-3943	CLIP-seq
MIRT2447672	hsa-miR-4257	CLIP-seq
MIRT2447673	hsa-miR-4295	CLIP-seq
MIRT910390	hsa-miR-4491	CLIP-seq
MIRT2447675	hsa-miR-454	CLIP-seq
MIRT910393	hsa-miR-4650-5p	CLIP-seq
MIRT910394	hsa-miR-4657	CLIP-seq
MIRT2447676	hsa-miR-4671-3p	CLIP-seq
MIRT910395	hsa-miR-4688	CLIP-seq
MIRT2447677	hsa-miR-4690-3p	CLIP-seq
MIRT2447678	hsa-miR-4708-3p	CLIP-seq
MIRT2447680	hsa-miR-4714-3p	CLIP-seq
MIRT910396	hsa-miR-4717-5p	CLIP-seq
MIRT2447681	hsa-miR-4722-3p	CLIP-seq
MIRT910398	hsa-miR-4764-5p	CLIP-seq
MIRT2447682	hsa-miR-4769-3p	CLIP-seq
MIRT2447683	hsa-miR-4772-3p	CLIP-seq
MIRT910400	hsa-miR-486-3p	CLIP-seq
MIRT910401	hsa-miR-510	CLIP-seq
MIRT910402	hsa-miR-642b	CLIP-seq
MIRT2447687	hsa-miR-942	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
CEBPA	Unknown	18524846
NFKB1	Unknown	18782567
SP1	Unknown	18524846

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004157	Function	Dihydropyrimidinase activity	IBA
GO:0005515	Function	Protein binding	IPI	15383276, 16169070, 21900206, 24722188, 25416956, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006139	Process	Nucleobase-containing compound metabolic process	TAS	8973361
GO:0006208	Process	Pyrimidine nucleobase catabolic process	IBA
GO:0007399	Process	Nervous system development	TAS	8973361
GO:0010977	Process	Negative regulation of neuron projection development	IGI	25358863
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016810	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds	IEA
GO:0016812	Function	Hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030496	Component	Midbody	IDA	19799413
GO:0031005	Function	Filamin binding	IPI	25358863
GO:0042802	Function	Identical protein binding	IPI	24722188, 25416956
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA

MIM	HGNC	e!Ensembl
602462	2365	ENSG00000072832

Q14194

Protein name

Dihydropyrimidinase-related protein 1 (DRP-1) (Collapsin response mediator protein 1) (CRMP-1) (Inactive dihydropyrimidinase) (Unc-33-like phosphoprotein 3) (ULIP-3)

Protein function

Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton (PubMed:25358863). Plays a role in axon guidance (PubMed:25358863). During the axon guidance process, acts downstream of SEMA3A to promote FLNA dissocia

PDB

4B3Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01979	Amidohydro_1	64 → 453	Amidohydrolase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Brain.

Sequence

MSYQGKKSIPHITSDRLLIKGGRIINDDQSLYADVYLEDGLIKQIGENLIVPGGVKTIEA
NGRMVIPGGIDVNTYLQKPSQGMTAADDFFQGTRAALVGGTTMIIDHVVPEPGSSLLTSF
EKWHEAADTKSCCDYSLHVDITSWYDGVREELEVLVQDKGVNSFQVYMAYKDVYQMSDSQ
LYEAFTFLKGLGAVILVHAENGDLIAQEQKRILEMGITGPEGHALSRPEELEAEAVFRAI
TIAGRINCPVYITKVMSKSAADIIALARKKGPLVFGEPIAASLGTDGTHYWSKNWAKAAA
FVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEE
RMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTI
TAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQ
RVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQSNFS
LSGAQIDDNNPRRTGHRIVAPPGGRSNITSLG

Sequence length

572

Interactions

View interactions

	Reactome
			CRMPs in Sema3A signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANHEDONIA, SOCIAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (119)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	14996858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	14996858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	26009886, 28025999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27677309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23713734, 29335339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27737949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27737949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29666369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	29666369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	24758576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23381229, 25434519, 25595902, 29072687, 30425235, 30809096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36454866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27456940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11562390, 12650609, 17592619, 23381229, 28025999, 31770286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27509055, 31409904, 31639424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30604255, 30993599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	28623750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28607103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30148677, 30447185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26009886, 28025999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28139514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22487795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23381229, 30258050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24905188, 26915633, 28384228, 30567380, 30938090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	29223396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29768513, 29924999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29768513, 29924999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31849103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25853493, 31063459, 31349216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	28939434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ellis-Van Creveld Syndrome	Ellis-Van Creveld Syndrome	CLINVAR_DG	10700184, 17024374, 19810119, 20184732, 23220543, 29068549, 29321360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29448246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27509055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28025999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28025999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	30171839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	31361992		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	26247724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24899388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28498803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19903856, 24899388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27495873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24905188, 26915633, 28384228, 30567380, 30938090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	29726929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	30290401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23641925, 29397067, 30449600, 30914652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18805504, 28808422, 30444033, 30447185, 31115753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29563985, 29981304, 31346611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	28190775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22511751, 28739174, 29431643, 30042687, 31336911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28294974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22367970, 28432138, 29464060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29906559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29435096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	27349577, 29890853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	28063983		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17118363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27542250		★★★★★ ★☆☆☆☆ Found in Text Mining only
Majewski Syndrome	Majewski Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	28222113	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23381229, 25434519, 25595902, 29072687, 30425235, 30809096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28025999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30981110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11562390, 12650609, 17592619, 23381229, 28025999, 31770286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31409904, 31639424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25658205, 31674061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27321179, 31838085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27864146, 28965855, 30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11562390, 12650609, 18524846, 21527248, 24011394, 27509055, 29290987, 31127452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22487795, 29329364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	26009886, 28025999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26009886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25174275, 30185782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	29666369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29245958, 30425163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28131843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17914117, 25595902, 25658205, 26356820, 27542250, 27864146, 27889261, 28606997, 29360576, 30540939, 30862036		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30801875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18980998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23417100, 24011394, 26518267, 28560384, 28591721, 31837427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23641925, 27830583, 28154157, 28379197, 28409390, 29290987, 31283035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28981157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24011394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31624314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27491814, 28683400, 28890359, 29092894, 29395086, 29419407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	38287382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31409904, 31639424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25658205, 31674061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31412251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20164189, 21292769, 22398207, 27267045, 27619562, 28531191, 31308800, 31578315, 31626851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27831567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27321179, 31838085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30042687, 31336911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	38110986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	26119034, 28294974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31825802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29704468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22798627		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22798627		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	25333879	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	29336470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Social Anhedonia	Social Anhedonia	PSYGENET_DG	22798627		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPASTIC ATAXIA, CHARLEVOIX-SAGUENAY TYPE	Spastic Ataxia	BEFREE	27288452, 28527629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28818497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28606997, 31127452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28479396, 28919853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27864146, 28965855, 30940726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28210956, 28579326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thoracic hypoplasia	Thoracic hypoplasia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	17403058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	37508512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31138329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29924999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vertical Talus	Vertical Talus	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Weyers acrofacial dysostosis	Weyers Acrofacial Dysostosis	CLINVAR_DG	10700184, 17024374, 23220543, 29068549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	LHGDN	15492864		★★★★★ ★☆☆☆☆ Found in Text Mining only

CRMP1 (collapsin response mediator protein 1)