ADORA3 (adenosine A3 receptor)

Gene

• Entrez ID: 140
• Gene name: Adenosine A3 receptor
• Gene symbol: ADORA3
• Synonyms (NCBI Gene): A3AR
• Chromosome: 1
• Chromosome location: 1p13.2
• Summary: This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT717466	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT717465	hsa-miR-15a-5p	HITS-CLIP	19536157
MIRT717464	hsa-miR-15b-5p	HITS-CLIP	19536157
MIRT717463	hsa-miR-16-5p	HITS-CLIP	19536157
MIRT717462	hsa-miR-195-5p	HITS-CLIP	19536157
MIRT717461	hsa-miR-424-5p	HITS-CLIP	19536157
MIRT717460	hsa-miR-497-5p	HITS-CLIP	19536157
MIRT717459	hsa-miR-6838-5p	HITS-CLIP	19536157
MIRT717458	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT717457	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT717456	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT717455	hsa-miR-103a-3p	HITS-CLIP	19536157
MIRT717454	hsa-miR-107	HITS-CLIP	19536157
MIRT717453	hsa-miR-324-5p	HITS-CLIP	19536157
MIRT717452	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT717451	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT717466	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT717465	hsa-miR-15a-5p	HITS-CLIP	19536157
MIRT717464	hsa-miR-15b-5p	HITS-CLIP	19536157
MIRT717463	hsa-miR-16-5p	HITS-CLIP	19536157
MIRT717462	hsa-miR-195-5p	HITS-CLIP	19536157
MIRT717461	hsa-miR-424-5p	HITS-CLIP	19536157
MIRT717460	hsa-miR-497-5p	HITS-CLIP	19536157
MIRT717459	hsa-miR-6838-5p	HITS-CLIP	19536157
MIRT717458	hsa-miR-188-5p	HITS-CLIP	19536157
MIRT717457	hsa-miR-6866-3p	HITS-CLIP	19536157
MIRT717456	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT717455	hsa-miR-103a-3p	HITS-CLIP	19536157
MIRT717454	hsa-miR-107	HITS-CLIP	19536157
MIRT717453	hsa-miR-324-5p	HITS-CLIP	19536157
MIRT717452	hsa-miR-204-5p	HITS-CLIP	19536157
MIRT717451	hsa-miR-211-5p	HITS-CLIP	19536157
MIRT769626	hsa-miR-219-5p	CLIP-seq
MIRT769627	hsa-miR-3064-5p	CLIP-seq
MIRT769628	hsa-miR-3921	CLIP-seq
MIRT769629	hsa-miR-4265	CLIP-seq
MIRT769630	hsa-miR-4296	CLIP-seq
MIRT769631	hsa-miR-4322	CLIP-seq
MIRT769632	hsa-miR-4417	CLIP-seq
MIRT769633	hsa-miR-4445	CLIP-seq
MIRT769634	hsa-miR-4640-5p	CLIP-seq
MIRT769635	hsa-miR-4649-3p	CLIP-seq
MIRT769636	hsa-miR-4653-5p	CLIP-seq
MIRT769637	hsa-miR-4726-5p	CLIP-seq
MIRT769638	hsa-miR-4782-3p	CLIP-seq
MIRT769639	hsa-miR-508-3p	CLIP-seq
MIRT769640	hsa-miR-548c-3p	CLIP-seq
MIRT769641	hsa-miR-604	CLIP-seq
MIRT769642	hsa-miR-647	CLIP-seq
MIRT2167943	hsa-miR-2110	CLIP-seq
MIRT2167944	hsa-miR-3974	CLIP-seq
MIRT2167945	hsa-miR-4271	CLIP-seq
MIRT2167946	hsa-miR-4725-3p	CLIP-seq
MIRT2167947	hsa-miR-493	CLIP-seq
MIRT2167948	hsa-miR-653	CLIP-seq
MIRT2383962	hsa-miR-1224-3p	CLIP-seq
MIRT2383963	hsa-miR-1260	CLIP-seq
MIRT2383964	hsa-miR-1260b	CLIP-seq
MIRT2383965	hsa-miR-1270	CLIP-seq
MIRT2383966	hsa-miR-1280	CLIP-seq
MIRT2383967	hsa-miR-4683	CLIP-seq
MIRT2383968	hsa-miR-4708-5p	CLIP-seq
MIRT2383969	hsa-miR-532-3p	CLIP-seq
MIRT2383970	hsa-miR-620	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	17216675
RELA	Unknown	17216675

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IBA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8399349
GO:0006954	Process	Inflammatory response	TAS	9164961
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	8399349, 9380026
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	9380026
GO:0008016	Process	Regulation of heart contraction	TAS	9837869
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	27886186
GO:0009611	Process	Response to wounding	TAS	9837869
GO:0014061	Process	Regulation of norepinephrine secretion	IEA
GO:0016020	Component	Membrane	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	27886186
GO:0030425	Component	Dendrite	IBA
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	27886186
GO:0042734	Component	Presynaptic membrane	IEA
GO:0045202	Component	Synapse	IBA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA

Other IDs

• MIM: 600445
• HGNC: 268
• e!Ensembl: ENSG00000282608

Protein

• UniProt ID: P0DMS8
• Protein name: Adenosine receptor A3
• Protein function: [Isoform 2]: Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase (PubMed:8234299).
• PDB: 8X16, 8X17
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	29 → 282	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the lung and bone. Expressed at lower levels in osteosarcoma tissues (at protein level). {ECO:0000269|PubMed:27886186}.
• Sequence:

  MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
  VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
  VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
  SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
  LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
  VVCHPSDSLDTSIEKNSE

• Sequence length: 318

Pathways

KEGG:

cGMP-PKG signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction

Reactome:

Adenosine P1 receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADORA3-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22146575, 31140226	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31875581	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29768061	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25077564		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35618744	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	22319752	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27893428		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17348028		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15355922		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29955603		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21675873		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	21675873		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27091178	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21675873		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19253308		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23956030		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	33478117	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	29955603	Associate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	31333098		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19253308, 24864134		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19253308, 24864134	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	28054643	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	8645277	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	18636149		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29768061		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36285419	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25077564		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29119938		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15147729, 18351132		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12160945, 20132822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	36553589	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	25077564		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23956030		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27886186		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	22319752	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31140226		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	18059189	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19253308, 27893428, 31714673		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36275756	Associate	★☆☆☆☆ Found in Text Mining only