Gene Gene information from NCBI Gene database.
Entrez ID 14
Gene name Angio associated migratory cell protein
Gene symbol AAMP
Synonyms (NCBI Gene)
-
Chromosome 2
Chromosome location 2q35
Summary The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via t
miRNA miRNA information provided by mirtarbase database.
73
miRTarBase ID miRNA Experiments Reference
MIRT030529 hsa-miR-24-3p Microarray 19748357
MIRT047035 hsa-miR-183-5p CLASH 23622248
MIRT041563 hsa-miR-193b-3p CLASH 23622248
MIRT038324 hsa-miR-130b-5p CLASH 23622248
MIRT037106 hsa-miR-877-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0001525 Process Angiogenesis NAS 10329261
GO:0005515 Function Protein binding IPI 28514442, 29892012, 32296183, 33961781
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603488 18 ENSG00000127837
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q13685
Protein name Angio-associated migratory cell protein
Protein function Plays a role in angiogenesis and cell migration. In smooth muscle cell migration, may act through the RhoA pathway.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00400 WD40 124 162 WD domain, G-beta repeat Repeat
PF00400 WD40 208 243 WD domain, G-beta repeat Repeat
PF00400 WD40 247 287 WD domain, G-beta repeat Repeat
PF00400 WD40 348 386 WD domain, G-beta repeat Repeat
PF00400 WD40 390 427 WD domain, G-beta repeat Repeat
Tissue specificity TISSUE SPECIFICITY: Expressed in metastatic melanoma, liver, skin, kidney, heart, lung, lymph node, skeletal muscle and brain, and also in A2058 melanoma cells and activated T-cells (at protein level). Expressed in blood vessels. Strongly expressed in end
Sequence
MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEG
NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR
LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR
IWD
LKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRP
ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSG
IVQLLWEAGTAVVYTCSLDGIVRLWD
ARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG
DHKAKVF
CVQRPDR
Sequence length 434
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    NOD1/2 Signaling Pathway
Signaling by EGFR
Signaling by VEGF
Thromboxane signalling through TP receptor
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SMOOTH SURFACE DENTAL CARIES GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Carcinoma Breast Carcinoma BEFREE 23564791
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 31075398
★☆☆☆☆
Found in Text Mining only
Intervertebral Disc Degeneration Intervertebral disc disease Pubtator 37122729 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 23564791
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of lung Lung Cancer BEFREE 31075398
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 23564791
★☆☆☆☆
Found in Text Mining only
Non-Small Cell Lung Carcinoma Lung carcinoma BEFREE 31075398
★☆☆☆☆
Found in Text Mining only
Noninfiltrating Intraductal Carcinoma Ductal carcinoma BEFREE 12473591
★☆☆☆☆
Found in Text Mining only