CRK (CRK proto-oncogene, adaptor protein)

Gene

• Entrez ID: 1398
• Gene name: CRK proto-oncogene, adaptor protein
• Gene symbol: CRK
• Synonyms (NCBI Gene): CRKII, p38
• Chromosome: 17
• Chromosome location: 17p13.3
• Summary: This gene encodes a member of an adapter protein family that binds to several tyrosine-phosphorylated proteins. The product of this gene has several SH2 and SH3 domains (src-homology domains) and is involved in several signaling pathways, recruiting cytop

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002993	hsa-miR-126-3p	Luciferase reporter assay	18602365
MIRT002993	hsa-miR-126-3p	Luciferase reporter assay, Western blot	18602365
MIRT002993	hsa-miR-126-3p	qRT-PCR	18602365
MIRT002993	hsa-miR-126-3p	Review	19935707
MIRT002993	hsa-miR-126-3p	Luciferase reporter assay	18602365
MIRT002993	hsa-miR-126-3p	Review	20130964
MIRT002993	hsa-miR-126-3p	Western blot	19767772
MIRT002993	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	20619534
MIRT002993	hsa-miR-126-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	20619534
MIRT007166	hsa-miR-132-3p	Luciferase reporter assay	23184980
MIRT002993	hsa-miR-126-3p	Sequencing	20371350
MIRT021297	hsa-miR-125a-5p	Sequencing	20371350
MIRT007166	hsa-miR-132-3p	Microarray	17612493
MIRT024820	hsa-miR-215-5p	Microarray	19074876
MIRT025620	hsa-miR-10a-5p	Sequencing	20371350
MIRT026885	hsa-miR-192-5p	Microarray	19074876
MIRT051574	hsa-let-7e-5p	CLASH	23622248
MIRT046474	hsa-miR-15b-5p	CLASH	23622248
MIRT038706	hsa-miR-129-1-3p	CLASH	23622248
MIRT038548	hsa-miR-106b-3p	CLASH	23622248
MIRT052687	hsa-miR-1260b	CLASH	23622248
MIRT002993	hsa-miR-126-3p	qRT-PCR, Western blot	24969300
MIRT002993	hsa-miR-126-3p	qRT-PCR, Western blot	25027343
MIRT639253	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT639252	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT639251	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT639250	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT639249	hsa-miR-6072	HITS-CLIP	23824327
MIRT639248	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT639247	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT639246	hsa-miR-1267	HITS-CLIP	23824327
MIRT639245	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT195992	hsa-miR-4320	HITS-CLIP	23824327
MIRT639244	hsa-miR-640	HITS-CLIP	23824327
MIRT639243	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT572166	hsa-miR-4790-3p	PAR-CLIP	20371350
MIRT572165	hsa-miR-6790-3p	PAR-CLIP	20371350
MIRT572164	hsa-miR-6821-3p	PAR-CLIP	20371350
MIRT572163	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT572162	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT144777	hsa-miR-1257	PAR-CLIP	20371350
MIRT572161	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT567947	hsa-miR-548n	PAR-CLIP	20371350
MIRT567946	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT567945	hsa-miR-548l	PAR-CLIP	20371350
MIRT567944	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT567943	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT567942	hsa-miR-664b-5p	PAR-CLIP	20371350
MIRT567941	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT524335	hsa-miR-216b-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512092	hsa-miR-370-3p	PAR-CLIP	20371350
MIRT512090	hsa-miR-6893-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT567940	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT567939	hsa-miR-520e	PAR-CLIP	20371350
MIRT567938	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT567937	hsa-miR-302e	PAR-CLIP	20371350
MIRT567936	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT567935	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT567934	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT567933	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT567932	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT567931	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT567930	hsa-miR-520b	PAR-CLIP	20371350
MIRT567929	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT567928	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT567927	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT567926	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT440877	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT567925	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT440876	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT567924	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT567923	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT567922	hsa-miR-320c	PAR-CLIP	20371350
MIRT567921	hsa-miR-4429	PAR-CLIP	20371350
MIRT567920	hsa-miR-320a	PAR-CLIP	20371350
MIRT567919	hsa-miR-320b	PAR-CLIP	20371350
MIRT567918	hsa-miR-320d	PAR-CLIP	20371350
MIRT567916	hsa-miR-3609	PAR-CLIP	20371350
MIRT567917	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT567915	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT567914	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT567912	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT567913	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT567911	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT567910	hsa-miR-31-3p	PAR-CLIP	20371350
MIRT567909	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT567908	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT548730	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT548729	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT548728	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT548727	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT046474	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT548726	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT548725	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT548724	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT548723	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT548722	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT548720	hsa-miR-5680	PAR-CLIP	21572407
MIRT548721	hsa-miR-646	PAR-CLIP	21572407
MIRT548719	hsa-miR-3163	PAR-CLIP	21572407
MIRT386618	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT548718	hsa-miR-298	PAR-CLIP	21572407
MIRT548717	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT548716	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT548715	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548713	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT548714	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT548712	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT548711	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT548710	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT548709	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT543019	hsa-miR-4418	PAR-CLIP	21572407
MIRT543018	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT543017	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT543016	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT543015	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT543014	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT543013	hsa-miR-1915-3p	PAR-CLIP	21572407
MIRT543012	hsa-miR-6764-5p	PAR-CLIP	21572407
MIRT543011	hsa-miR-4726-3p	PAR-CLIP	21572407
MIRT543010	hsa-miR-6741-3p	PAR-CLIP	21572407
MIRT543009	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT543008	hsa-miR-1184	PAR-CLIP	21572407
MIRT543006	hsa-miR-4284	PAR-CLIP	21572407
MIRT543007	hsa-miR-7843-3p	PAR-CLIP	21572407
MIRT543005	hsa-miR-127-5p	PAR-CLIP	21572407
MIRT543004	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT285743	hsa-miR-8485	PAR-CLIP	23446348
MIRT512099	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT512098	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT512097	hsa-miR-603	PAR-CLIP	23446348
MIRT512096	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT524335	hsa-miR-216b-3p	PAR-CLIP	23446348
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT512092	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT512090	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT512091	hsa-miR-6128	PAR-CLIP	23446348
MIRT512088	hsa-miR-1-3p	PAR-CLIP	23446348
MIRT512087	hsa-miR-206	PAR-CLIP	23446348
MIRT512086	hsa-miR-613	PAR-CLIP	23446348
MIRT512085	hsa-miR-3941	PAR-CLIP	23446348
MIRT512084	hsa-miR-5096	PAR-CLIP	23446348
MIRT285743	hsa-miR-8485	PAR-CLIP	23446348
MIRT512099	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT512098	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT512097	hsa-miR-603	PAR-CLIP	23446348
MIRT512096	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT512092	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT512090	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT512091	hsa-miR-6128	PAR-CLIP	23446348
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	23446348
MIRT512088	hsa-miR-1-3p	PAR-CLIP	23446348
MIRT512087	hsa-miR-206	PAR-CLIP	23446348
MIRT512086	hsa-miR-613	PAR-CLIP	23446348
MIRT512085	hsa-miR-3941	PAR-CLIP	23446348
MIRT512084	hsa-miR-5096	PAR-CLIP	23446348
MIRT440877	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT440876	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439167	hsa-let-7c-5p	3'LIFE	25074381
MIRT439131	hsa-miR-10b-5p	3'LIFE	25074381
MIRT440877	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT567928	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT567923	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT567924	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT567927	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT440876	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439167	hsa-let-7c-5p	3'LIFE	25074381
MIRT439131	hsa-miR-10b-5p	3'LIFE	25074381
MIRT002993	hsa-miR-126-3p	qRT-PCR	27785060
MIRT572163	hsa-miR-4747-5p	PAR-CLIP	27292025
MIRT572162	hsa-miR-5196-5p	PAR-CLIP	27292025
MIRT639253	hsa-miR-512-5p	HITS-CLIP	23824327
MIRT639252	hsa-miR-510-5p	HITS-CLIP	23824327
MIRT639251	hsa-miR-4778-5p	HITS-CLIP	23824327
MIRT639250	hsa-miR-1207-3p	HITS-CLIP	23824327
MIRT639249	hsa-miR-6072	HITS-CLIP	23824327
MIRT639248	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT639247	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT639246	hsa-miR-1267	HITS-CLIP	23824327
MIRT639245	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT195992	hsa-miR-4320	HITS-CLIP	23824327
MIRT639244	hsa-miR-640	HITS-CLIP	23824327
MIRT639243	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT572166	hsa-miR-4790-3p	PAR-CLIP	20371350
MIRT572165	hsa-miR-6790-3p	PAR-CLIP	20371350
MIRT572164	hsa-miR-6821-3p	PAR-CLIP	20371350
MIRT572163	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT572162	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT144777	hsa-miR-1257	PAR-CLIP	20371350
MIRT572161	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT567947	hsa-miR-548n	PAR-CLIP	20371350
MIRT567946	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT567945	hsa-miR-548l	PAR-CLIP	20371350
MIRT567944	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT567943	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT567942	hsa-miR-664b-5p	PAR-CLIP	20371350
MIRT567941	hsa-miR-135b-3p	PAR-CLIP	20371350
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT524335	hsa-miR-216b-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512092	hsa-miR-370-3p	PAR-CLIP	20371350
MIRT512090	hsa-miR-6893-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT567940	hsa-miR-302c-3p	PAR-CLIP	20371350
MIRT567939	hsa-miR-520e	PAR-CLIP	20371350
MIRT567938	hsa-miR-302b-3p	PAR-CLIP	20371350
MIRT567937	hsa-miR-302e	PAR-CLIP	20371350
MIRT567936	hsa-miR-372-3p	PAR-CLIP	20371350
MIRT567935	hsa-miR-302a-3p	PAR-CLIP	20371350
MIRT567934	hsa-miR-520d-3p	PAR-CLIP	20371350
MIRT567933	hsa-miR-520c-3p	PAR-CLIP	20371350
MIRT567932	hsa-miR-373-3p	PAR-CLIP	20371350
MIRT567931	hsa-miR-520a-3p	PAR-CLIP	20371350
MIRT567930	hsa-miR-520b	PAR-CLIP	20371350
MIRT567929	hsa-miR-302d-3p	PAR-CLIP	20371350
MIRT567928	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT567927	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT567926	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT440877	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT567925	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT440876	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT567924	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT567923	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT567922	hsa-miR-320c	PAR-CLIP	20371350
MIRT567921	hsa-miR-4429	PAR-CLIP	20371350
MIRT567920	hsa-miR-320a	PAR-CLIP	20371350
MIRT567919	hsa-miR-320b	PAR-CLIP	20371350
MIRT567918	hsa-miR-320d	PAR-CLIP	20371350
MIRT567916	hsa-miR-3609	PAR-CLIP	20371350
MIRT567917	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT567915	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT567914	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT567912	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT567913	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT567911	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT567910	hsa-miR-31-3p	PAR-CLIP	20371350
MIRT567909	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT567908	hsa-miR-9-3p	PAR-CLIP	20371350
MIRT285743	hsa-miR-8485	PAR-CLIP	20371350
MIRT512099	hsa-miR-329-3p	PAR-CLIP	20371350
MIRT512098	hsa-miR-362-3p	PAR-CLIP	20371350
MIRT512097	hsa-miR-603	PAR-CLIP	20371350
MIRT512096	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT512091	hsa-miR-6128	PAR-CLIP	20371350
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	20371350
MIRT512088	hsa-miR-1-3p	PAR-CLIP	20371350
MIRT512087	hsa-miR-206	PAR-CLIP	20371350
MIRT512086	hsa-miR-613	PAR-CLIP	20371350
MIRT512085	hsa-miR-3941	PAR-CLIP	20371350
MIRT512084	hsa-miR-5096	PAR-CLIP	20371350
MIRT548730	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT548729	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT548728	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT548727	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT046474	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT548726	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT548725	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT548724	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT548723	hsa-miR-410-3p	PAR-CLIP	21572407
MIRT548722	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT548720	hsa-miR-5680	PAR-CLIP	21572407
MIRT548721	hsa-miR-646	PAR-CLIP	21572407
MIRT548719	hsa-miR-3163	PAR-CLIP	21572407
MIRT386618	hsa-miR-205-3p	PAR-CLIP	21572407
MIRT548718	hsa-miR-298	PAR-CLIP	21572407
MIRT548717	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT548716	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT548715	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548713	hsa-miR-1273h-3p	PAR-CLIP	21572407
MIRT548714	hsa-miR-3678-3p	PAR-CLIP	21572407
MIRT548712	hsa-miR-6516-5p	PAR-CLIP	21572407
MIRT548711	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT548710	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT548709	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT543019	hsa-miR-4418	PAR-CLIP	21572407
MIRT543018	hsa-miR-509-3-5p	PAR-CLIP	21572407
MIRT543017	hsa-miR-509-5p	PAR-CLIP	21572407
MIRT543016	hsa-miR-1306-5p	PAR-CLIP	21572407
MIRT543015	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT543014	hsa-miR-6840-3p	PAR-CLIP	21572407
MIRT543013	hsa-miR-1915-3p	PAR-CLIP	21572407
MIRT543012	hsa-miR-6764-5p	PAR-CLIP	21572407
MIRT543011	hsa-miR-4726-3p	PAR-CLIP	21572407
MIRT543010	hsa-miR-6741-3p	PAR-CLIP	21572407
MIRT543009	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT543008	hsa-miR-1184	PAR-CLIP	21572407
MIRT543006	hsa-miR-4284	PAR-CLIP	21572407
MIRT543007	hsa-miR-7843-3p	PAR-CLIP	21572407
MIRT543005	hsa-miR-127-5p	PAR-CLIP	21572407
MIRT543004	hsa-miR-7156-3p	PAR-CLIP	21572407
MIRT285743	hsa-miR-8485	PAR-CLIP	23446348
MIRT512099	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT512098	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT512097	hsa-miR-603	PAR-CLIP	23446348
MIRT512096	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT524335	hsa-miR-216b-3p	PAR-CLIP	23446348
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT512092	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT512090	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT512091	hsa-miR-6128	PAR-CLIP	23446348
MIRT512088	hsa-miR-1-3p	PAR-CLIP	23446348
MIRT512087	hsa-miR-206	PAR-CLIP	23446348
MIRT512086	hsa-miR-613	PAR-CLIP	23446348
MIRT512085	hsa-miR-3941	PAR-CLIP	23446348
MIRT512084	hsa-miR-5096	PAR-CLIP	23446348
MIRT285743	hsa-miR-8485	PAR-CLIP	23446348
MIRT512099	hsa-miR-329-3p	PAR-CLIP	23446348
MIRT512098	hsa-miR-362-3p	PAR-CLIP	23446348
MIRT512097	hsa-miR-603	PAR-CLIP	23446348
MIRT512096	hsa-miR-619-3p	PAR-CLIP	23446348
MIRT512095	hsa-miR-3622a-3p	PAR-CLIP	23446348
MIRT512094	hsa-miR-3622b-3p	PAR-CLIP	23446348
MIRT512093	hsa-miR-6765-3p	PAR-CLIP	23446348
MIRT512092	hsa-miR-370-3p	PAR-CLIP	23446348
MIRT512090	hsa-miR-6893-3p	PAR-CLIP	23446348
MIRT512091	hsa-miR-6128	PAR-CLIP	23446348
MIRT512089	hsa-miR-3140-3p	PAR-CLIP	23446348
MIRT512088	hsa-miR-1-3p	PAR-CLIP	23446348
MIRT512087	hsa-miR-206	PAR-CLIP	23446348
MIRT512086	hsa-miR-613	PAR-CLIP	23446348
MIRT512085	hsa-miR-3941	PAR-CLIP	23446348
MIRT512084	hsa-miR-5096	PAR-CLIP	23446348
MIRT909900	hsa-miR-106a	CLIP-seq
MIRT909901	hsa-miR-106b	CLIP-seq
MIRT909902	hsa-miR-1234	CLIP-seq
MIRT909903	hsa-miR-1237	CLIP-seq
MIRT909904	hsa-miR-1258	CLIP-seq
MIRT909905	hsa-miR-1273e	CLIP-seq
MIRT909906	hsa-miR-1287	CLIP-seq
MIRT909907	hsa-miR-1307	CLIP-seq
MIRT909908	hsa-miR-141	CLIP-seq
MIRT909909	hsa-miR-146b-3p	CLIP-seq
MIRT909910	hsa-miR-150	CLIP-seq
MIRT909911	hsa-miR-17	CLIP-seq
MIRT909912	hsa-miR-188-5p	CLIP-seq
MIRT909913	hsa-miR-194	CLIP-seq
MIRT909914	hsa-miR-200a	CLIP-seq
MIRT909915	hsa-miR-203	CLIP-seq
MIRT909916	hsa-miR-20a	CLIP-seq
MIRT909917	hsa-miR-20b	CLIP-seq
MIRT909918	hsa-miR-22	CLIP-seq
MIRT909919	hsa-miR-302a	CLIP-seq
MIRT909920	hsa-miR-302b	CLIP-seq
MIRT909921	hsa-miR-302c	CLIP-seq
MIRT909922	hsa-miR-302d	CLIP-seq
MIRT909923	hsa-miR-3117-3p	CLIP-seq
MIRT909924	hsa-miR-3155	CLIP-seq
MIRT909925	hsa-miR-3155b	CLIP-seq
MIRT909926	hsa-miR-3157-3p	CLIP-seq
MIRT909927	hsa-miR-3169	CLIP-seq
MIRT909928	hsa-miR-3170	CLIP-seq
MIRT909929	hsa-miR-3173-5p	CLIP-seq
MIRT909930	hsa-miR-3187-3p	CLIP-seq
MIRT909931	hsa-miR-3192	CLIP-seq
MIRT909932	hsa-miR-329	CLIP-seq
MIRT909933	hsa-miR-339-5p	CLIP-seq
MIRT909934	hsa-miR-3606	CLIP-seq
MIRT909935	hsa-miR-3652	CLIP-seq
MIRT909936	hsa-miR-3663-5p	CLIP-seq
MIRT909937	hsa-miR-370	CLIP-seq
MIRT909938	hsa-miR-372	CLIP-seq
MIRT909939	hsa-miR-373	CLIP-seq
MIRT909940	hsa-miR-377	CLIP-seq
MIRT909941	hsa-miR-431	CLIP-seq
MIRT909942	hsa-miR-433	CLIP-seq
MIRT909943	hsa-miR-4427	CLIP-seq
MIRT909944	hsa-miR-4430	CLIP-seq
MIRT909945	hsa-miR-4435	CLIP-seq
MIRT909946	hsa-miR-4438	CLIP-seq
MIRT909947	hsa-miR-4466	CLIP-seq
MIRT909948	hsa-miR-4499	CLIP-seq
MIRT909949	hsa-miR-4638-5p	CLIP-seq
MIRT909950	hsa-miR-4661-3p	CLIP-seq
MIRT909951	hsa-miR-4666-3p	CLIP-seq
MIRT909952	hsa-miR-4701-5p	CLIP-seq
MIRT909953	hsa-miR-4731-5p	CLIP-seq
MIRT909954	hsa-miR-4755-3p	CLIP-seq
MIRT909955	hsa-miR-4759	CLIP-seq
MIRT909956	hsa-miR-4762-3p	CLIP-seq
MIRT909957	hsa-miR-4766-5p	CLIP-seq
MIRT909958	hsa-miR-4781-3p	CLIP-seq
MIRT909959	hsa-miR-4793-5p	CLIP-seq
MIRT909960	hsa-miR-484	CLIP-seq
MIRT909961	hsa-miR-5095	CLIP-seq
MIRT909962	hsa-miR-512-3p	CLIP-seq
MIRT909963	hsa-miR-513a-5p	CLIP-seq
MIRT909964	hsa-miR-519d	CLIP-seq
MIRT909965	hsa-miR-520g	CLIP-seq
MIRT909966	hsa-miR-520h	CLIP-seq
MIRT909967	hsa-miR-548ah	CLIP-seq
MIRT909968	hsa-miR-548s	CLIP-seq
MIRT909969	hsa-miR-588	CLIP-seq
MIRT909970	hsa-miR-622	CLIP-seq
MIRT909971	hsa-miR-627	CLIP-seq
MIRT909972	hsa-miR-651	CLIP-seq
MIRT909973	hsa-miR-675	CLIP-seq
MIRT909974	hsa-miR-767-5p	CLIP-seq
MIRT909975	hsa-miR-874	CLIP-seq
MIRT909976	hsa-miR-892b	CLIP-seq
MIRT909977	hsa-miR-921	CLIP-seq
MIRT909978	hsa-miR-924	CLIP-seq
MIRT909979	hsa-miR-93	CLIP-seq
MIRT1921968	hsa-miR-1273f	CLIP-seq
MIRT909928	hsa-miR-3170	CLIP-seq
MIRT909930	hsa-miR-3187-3p	CLIP-seq
MIRT909936	hsa-miR-3663-5p	CLIP-seq
MIRT909942	hsa-miR-433	CLIP-seq
MIRT909945	hsa-miR-4435	CLIP-seq
MIRT1921969	hsa-miR-4524	CLIP-seq
MIRT909952	hsa-miR-4701-5p	CLIP-seq
MIRT909954	hsa-miR-4755-3p	CLIP-seq
MIRT1921970	hsa-miR-4756-3p	CLIP-seq
MIRT909958	hsa-miR-4781-3p	CLIP-seq
MIRT909968	hsa-miR-548s	CLIP-seq
MIRT909969	hsa-miR-588	CLIP-seq
MIRT1921968	hsa-miR-1273f	CLIP-seq
MIRT909928	hsa-miR-3170	CLIP-seq
MIRT909930	hsa-miR-3187-3p	CLIP-seq
MIRT909936	hsa-miR-3663-5p	CLIP-seq
MIRT909942	hsa-miR-433	CLIP-seq
MIRT909945	hsa-miR-4435	CLIP-seq
MIRT1921969	hsa-miR-4524	CLIP-seq
MIRT909952	hsa-miR-4701-5p	CLIP-seq
MIRT909954	hsa-miR-4755-3p	CLIP-seq
MIRT1921970	hsa-miR-4756-3p	CLIP-seq
MIRT909958	hsa-miR-4781-3p	CLIP-seq
MIRT909968	hsa-miR-548s	CLIP-seq
MIRT909969	hsa-miR-588	CLIP-seq
MIRT1969684	hsa-miR-1	CLIP-seq
MIRT1969685	hsa-miR-10a	CLIP-seq
MIRT1969686	hsa-miR-10b	CLIP-seq
MIRT1969687	hsa-miR-126	CLIP-seq
MIRT909905	hsa-miR-1273e	CLIP-seq
MIRT1921968	hsa-miR-1273f	CLIP-seq
MIRT1969688	hsa-miR-1275	CLIP-seq
MIRT909906	hsa-miR-1287	CLIP-seq
MIRT1969689	hsa-miR-1291	CLIP-seq
MIRT1969690	hsa-miR-1305	CLIP-seq
MIRT909907	hsa-miR-1307	CLIP-seq
MIRT909908	hsa-miR-141	CLIP-seq
MIRT1969691	hsa-miR-145	CLIP-seq
MIRT1969692	hsa-miR-186	CLIP-seq
MIRT909912	hsa-miR-188-5p	CLIP-seq
MIRT1969693	hsa-miR-1915	CLIP-seq
MIRT1969694	hsa-miR-192	CLIP-seq
MIRT909913	hsa-miR-194	CLIP-seq
MIRT1969695	hsa-miR-1976	CLIP-seq
MIRT909914	hsa-miR-200a	CLIP-seq
MIRT909915	hsa-miR-203	CLIP-seq
MIRT1969696	hsa-miR-215	CLIP-seq
MIRT909918	hsa-miR-22	CLIP-seq
MIRT1969697	hsa-miR-2467-3p	CLIP-seq
MIRT1969698	hsa-miR-3064-5p	CLIP-seq
MIRT1969699	hsa-miR-31	CLIP-seq
MIRT1969700	hsa-miR-3135b	CLIP-seq
MIRT1969701	hsa-miR-3140-5p	CLIP-seq
MIRT1969702	hsa-miR-3154	CLIP-seq
MIRT909924	hsa-miR-3155	CLIP-seq
MIRT909925	hsa-miR-3155b	CLIP-seq
MIRT909928	hsa-miR-3170	CLIP-seq
MIRT1969703	hsa-miR-3173-3p	CLIP-seq
MIRT909929	hsa-miR-3173-5p	CLIP-seq
MIRT909930	hsa-miR-3187-3p	CLIP-seq
MIRT909931	hsa-miR-3192	CLIP-seq
MIRT1969704	hsa-miR-328	CLIP-seq
MIRT909932	hsa-miR-329	CLIP-seq
MIRT1969705	hsa-miR-330-3p	CLIP-seq
MIRT909934	hsa-miR-3606	CLIP-seq
MIRT1969706	hsa-miR-3612	CLIP-seq
MIRT1969707	hsa-miR-3616-3p	CLIP-seq
MIRT1969708	hsa-miR-3622a-5p	CLIP-seq
MIRT1969709	hsa-miR-3647-3p	CLIP-seq
MIRT909935	hsa-miR-3652	CLIP-seq
MIRT909936	hsa-miR-3663-5p	CLIP-seq
MIRT1969710	hsa-miR-3673	CLIP-seq
MIRT1969711	hsa-miR-3682-5p	CLIP-seq
MIRT1969712	hsa-miR-3692	CLIP-seq
MIRT909937	hsa-miR-370	CLIP-seq
MIRT909940	hsa-miR-377	CLIP-seq
MIRT1969713	hsa-miR-421	CLIP-seq
MIRT1969714	hsa-miR-4269	CLIP-seq
MIRT1969715	hsa-miR-4279	CLIP-seq
MIRT1969716	hsa-miR-4324	CLIP-seq
MIRT1969717	hsa-miR-4325	CLIP-seq
MIRT909942	hsa-miR-433	CLIP-seq
MIRT909943	hsa-miR-4427	CLIP-seq
MIRT909944	hsa-miR-4430	CLIP-seq
MIRT909945	hsa-miR-4435	CLIP-seq
MIRT1969718	hsa-miR-4436b-3p	CLIP-seq
MIRT1969719	hsa-miR-4436b-5p	CLIP-seq
MIRT909946	hsa-miR-4438	CLIP-seq
MIRT1969720	hsa-miR-4464	CLIP-seq
MIRT909948	hsa-miR-4499	CLIP-seq
MIRT1969721	hsa-miR-4525	CLIP-seq
MIRT909949	hsa-miR-4638-5p	CLIP-seq
MIRT909950	hsa-miR-4661-3p	CLIP-seq
MIRT1969722	hsa-miR-4665-5p	CLIP-seq
MIRT909951	hsa-miR-4666-3p	CLIP-seq
MIRT1969723	hsa-miR-4687-3p	CLIP-seq
MIRT1969724	hsa-miR-4695-5p	CLIP-seq
MIRT909952	hsa-miR-4701-5p	CLIP-seq
MIRT1969725	hsa-miR-4718	CLIP-seq
MIRT1969726	hsa-miR-4722-3p	CLIP-seq
MIRT1969727	hsa-miR-4723-5p	CLIP-seq
MIRT1969728	hsa-miR-4731-3p	CLIP-seq
MIRT1969729	hsa-miR-4740-3p	CLIP-seq
MIRT1969730	hsa-miR-4748	CLIP-seq
MIRT909954	hsa-miR-4755-3p	CLIP-seq
MIRT1921970	hsa-miR-4756-3p	CLIP-seq
MIRT909957	hsa-miR-4766-5p	CLIP-seq
MIRT909958	hsa-miR-4781-3p	CLIP-seq
MIRT909959	hsa-miR-4793-5p	CLIP-seq
MIRT1969731	hsa-miR-4801	CLIP-seq
MIRT909960	hsa-miR-484	CLIP-seq
MIRT1969732	hsa-miR-507	CLIP-seq
MIRT1969733	hsa-miR-509-3p	CLIP-seq
MIRT909961	hsa-miR-5095	CLIP-seq
MIRT1969734	hsa-miR-539	CLIP-seq
MIRT909968	hsa-miR-548s	CLIP-seq
MIRT1969735	hsa-miR-552	CLIP-seq
MIRT1969736	hsa-miR-557	CLIP-seq
MIRT909969	hsa-miR-588	CLIP-seq
MIRT1969737	hsa-miR-600	CLIP-seq
MIRT1969738	hsa-miR-607	CLIP-seq
MIRT1969739	hsa-miR-619	CLIP-seq
MIRT1969740	hsa-miR-625	CLIP-seq
MIRT1969741	hsa-miR-650	CLIP-seq
MIRT1969742	hsa-miR-671-3p	CLIP-seq
MIRT909974	hsa-miR-767-5p	CLIP-seq
MIRT909976	hsa-miR-892b	CLIP-seq
MIRT909977	hsa-miR-921	CLIP-seq
MIRT1969684	hsa-miR-1	CLIP-seq
MIRT909900	hsa-miR-106a	CLIP-seq
MIRT909901	hsa-miR-106b	CLIP-seq
MIRT909902	hsa-miR-1234	CLIP-seq
MIRT909903	hsa-miR-1237	CLIP-seq
MIRT909905	hsa-miR-1273e	CLIP-seq
MIRT1921968	hsa-miR-1273f	CLIP-seq
MIRT909907	hsa-miR-1307	CLIP-seq
MIRT2205802	hsa-miR-132	CLIP-seq
MIRT909908	hsa-miR-141	CLIP-seq
MIRT909910	hsa-miR-150	CLIP-seq
MIRT909911	hsa-miR-17	CLIP-seq
MIRT909912	hsa-miR-188-5p	CLIP-seq
MIRT2205803	hsa-miR-191	CLIP-seq
MIRT1969693	hsa-miR-1915	CLIP-seq
MIRT909913	hsa-miR-194	CLIP-seq
MIRT909914	hsa-miR-200a	CLIP-seq
MIRT909915	hsa-miR-203	CLIP-seq
MIRT909916	hsa-miR-20a	CLIP-seq
MIRT909917	hsa-miR-20b	CLIP-seq
MIRT2205804	hsa-miR-212	CLIP-seq
MIRT2205805	hsa-miR-300	CLIP-seq
MIRT909919	hsa-miR-302a	CLIP-seq
MIRT909920	hsa-miR-302b	CLIP-seq
MIRT909921	hsa-miR-302c	CLIP-seq
MIRT909922	hsa-miR-302d	CLIP-seq
MIRT1969699	hsa-miR-31	CLIP-seq
MIRT909928	hsa-miR-3170	CLIP-seq
MIRT1969703	hsa-miR-3173-3p	CLIP-seq
MIRT909930	hsa-miR-3187-3p	CLIP-seq
MIRT909932	hsa-miR-329	CLIP-seq
MIRT1969706	hsa-miR-3612	CLIP-seq
MIRT1969709	hsa-miR-3647-3p	CLIP-seq
MIRT909936	hsa-miR-3663-5p	CLIP-seq
MIRT1969710	hsa-miR-3673	CLIP-seq
MIRT1969711	hsa-miR-3682-5p	CLIP-seq
MIRT909937	hsa-miR-370	CLIP-seq
MIRT909938	hsa-miR-372	CLIP-seq
MIRT909939	hsa-miR-373	CLIP-seq
MIRT2205806	hsa-miR-381	CLIP-seq
MIRT2205807	hsa-miR-4302	CLIP-seq
MIRT1969716	hsa-miR-4324	CLIP-seq
MIRT1969717	hsa-miR-4325	CLIP-seq
MIRT909942	hsa-miR-433	CLIP-seq
MIRT909943	hsa-miR-4427	CLIP-seq
MIRT909945	hsa-miR-4435	CLIP-seq
MIRT2205808	hsa-miR-4445	CLIP-seq
MIRT909947	hsa-miR-4466	CLIP-seq
MIRT2205809	hsa-miR-4519	CLIP-seq
MIRT1921969	hsa-miR-4524	CLIP-seq
MIRT2205810	hsa-miR-4637	CLIP-seq
MIRT909949	hsa-miR-4638-5p	CLIP-seq
MIRT2205811	hsa-miR-4651	CLIP-seq
MIRT909950	hsa-miR-4661-3p	CLIP-seq
MIRT909951	hsa-miR-4666-3p	CLIP-seq
MIRT1969724	hsa-miR-4695-5p	CLIP-seq
MIRT909952	hsa-miR-4701-5p	CLIP-seq
MIRT909953	hsa-miR-4731-5p	CLIP-seq
MIRT909954	hsa-miR-4755-3p	CLIP-seq
MIRT1921970	hsa-miR-4756-3p	CLIP-seq
MIRT909956	hsa-miR-4762-3p	CLIP-seq
MIRT909957	hsa-miR-4766-5p	CLIP-seq
MIRT909958	hsa-miR-4781-3p	CLIP-seq
MIRT2205812	hsa-miR-4787-5p	CLIP-seq
MIRT2205813	hsa-miR-4789-5p	CLIP-seq
MIRT909959	hsa-miR-4793-5p	CLIP-seq
MIRT1969732	hsa-miR-507	CLIP-seq
MIRT909961	hsa-miR-5095	CLIP-seq
MIRT909962	hsa-miR-512-3p	CLIP-seq
MIRT909964	hsa-miR-519d	CLIP-seq
MIRT909965	hsa-miR-520g	CLIP-seq
MIRT909966	hsa-miR-520h	CLIP-seq
MIRT2205814	hsa-miR-545	CLIP-seq
MIRT2205815	hsa-miR-548aa	CLIP-seq
MIRT2205816	hsa-miR-548p	CLIP-seq
MIRT909968	hsa-miR-548s	CLIP-seq
MIRT1969735	hsa-miR-552	CLIP-seq
MIRT2205817	hsa-miR-555	CLIP-seq
MIRT1969736	hsa-miR-557	CLIP-seq
MIRT2205818	hsa-miR-570	CLIP-seq
MIRT909969	hsa-miR-588	CLIP-seq
MIRT2205819	hsa-miR-608	CLIP-seq
MIRT1969739	hsa-miR-619	CLIP-seq
MIRT909970	hsa-miR-622	CLIP-seq
MIRT1969741	hsa-miR-650	CLIP-seq
MIRT909972	hsa-miR-651	CLIP-seq
MIRT909973	hsa-miR-675	CLIP-seq
MIRT909974	hsa-miR-767-5p	CLIP-seq
MIRT909979	hsa-miR-93	CLIP-seq
MIRT2205802	hsa-miR-132	CLIP-seq
MIRT2205803	hsa-miR-191	CLIP-seq
MIRT2205804	hsa-miR-212	CLIP-seq
MIRT2205811	hsa-miR-4651	CLIP-seq
MIRT2205812	hsa-miR-4787-5p	CLIP-seq
MIRT2205819	hsa-miR-608	CLIP-seq
MIRT909970	hsa-miR-622	CLIP-seq
MIRT1969685	hsa-miR-10a	CLIP-seq
MIRT1969686	hsa-miR-10b	CLIP-seq
MIRT1969687	hsa-miR-126	CLIP-seq
MIRT1969691	hsa-miR-145	CLIP-seq
MIRT2436470	hsa-miR-3925-3p	CLIP-seq
MIRT2436471	hsa-miR-4290	CLIP-seq
MIRT2436472	hsa-miR-4687-5p	CLIP-seq
MIRT1969728	hsa-miR-4731-3p	CLIP-seq
MIRT1969731	hsa-miR-4801	CLIP-seq
MIRT1969685	hsa-miR-10a	CLIP-seq
MIRT1969686	hsa-miR-10b	CLIP-seq
MIRT909903	hsa-miR-1237	CLIP-seq
MIRT909904	hsa-miR-1258	CLIP-seq
MIRT1969687	hsa-miR-126	CLIP-seq
MIRT909905	hsa-miR-1273e	CLIP-seq
MIRT1969688	hsa-miR-1275	CLIP-seq
MIRT2509060	hsa-miR-1281	CLIP-seq
MIRT909906	hsa-miR-1287	CLIP-seq
MIRT1969689	hsa-miR-1291	CLIP-seq
MIRT909907	hsa-miR-1307	CLIP-seq
MIRT2205802	hsa-miR-132	CLIP-seq
MIRT909908	hsa-miR-141	CLIP-seq
MIRT1969691	hsa-miR-145	CLIP-seq
MIRT909909	hsa-miR-146b-3p	CLIP-seq
MIRT2509061	hsa-miR-151-3p	CLIP-seq
MIRT1969692	hsa-miR-186	CLIP-seq
MIRT909912	hsa-miR-188-5p	CLIP-seq
MIRT2205803	hsa-miR-191	CLIP-seq
MIRT1969693	hsa-miR-1915	CLIP-seq
MIRT1969694	hsa-miR-192	CLIP-seq
MIRT909913	hsa-miR-194	CLIP-seq
MIRT1969695	hsa-miR-1976	CLIP-seq
MIRT909914	hsa-miR-200a	CLIP-seq
MIRT2509062	hsa-miR-200b	CLIP-seq
MIRT2509063	hsa-miR-200c	CLIP-seq
MIRT2509064	hsa-miR-2054	CLIP-seq
MIRT2509065	hsa-miR-208a	CLIP-seq
MIRT2509066	hsa-miR-208b	CLIP-seq
MIRT2205804	hsa-miR-212	CLIP-seq
MIRT1969696	hsa-miR-215	CLIP-seq
MIRT909918	hsa-miR-22	CLIP-seq
MIRT1969697	hsa-miR-2467-3p	CLIP-seq
MIRT2205805	hsa-miR-300	CLIP-seq
MIRT2509067	hsa-miR-3074-3p	CLIP-seq
MIRT1969699	hsa-miR-31	CLIP-seq
MIRT909923	hsa-miR-3117-3p	CLIP-seq
MIRT1969700	hsa-miR-3135b	CLIP-seq
MIRT1969701	hsa-miR-3140-5p	CLIP-seq
MIRT1969702	hsa-miR-3154	CLIP-seq
MIRT909924	hsa-miR-3155	CLIP-seq
MIRT909925	hsa-miR-3155b	CLIP-seq
MIRT909926	hsa-miR-3157-3p	CLIP-seq
MIRT2509068	hsa-miR-3162-3p	CLIP-seq
MIRT909927	hsa-miR-3169	CLIP-seq
MIRT1969703	hsa-miR-3173-3p	CLIP-seq
MIRT909929	hsa-miR-3173-5p	CLIP-seq
MIRT2509069	hsa-miR-3180-5p	CLIP-seq
MIRT909931	hsa-miR-3192	CLIP-seq
MIRT1969704	hsa-miR-328	CLIP-seq
MIRT909932	hsa-miR-329	CLIP-seq
MIRT909933	hsa-miR-339-5p	CLIP-seq
MIRT2509070	hsa-miR-34a	CLIP-seq
MIRT2509071	hsa-miR-34c-5p	CLIP-seq
MIRT2509072	hsa-miR-3607-3p	CLIP-seq
MIRT1969706	hsa-miR-3612	CLIP-seq
MIRT2509073	hsa-miR-361-5p	CLIP-seq
MIRT1969707	hsa-miR-3616-3p	CLIP-seq
MIRT1969708	hsa-miR-3622a-5p	CLIP-seq
MIRT1969709	hsa-miR-3647-3p	CLIP-seq
MIRT909935	hsa-miR-3652	CLIP-seq
MIRT2509074	hsa-miR-3667-3p	CLIP-seq
MIRT1969711	hsa-miR-3682-5p	CLIP-seq
MIRT2509075	hsa-miR-3686	CLIP-seq
MIRT1969712	hsa-miR-3692	CLIP-seq
MIRT909937	hsa-miR-370	CLIP-seq
MIRT909940	hsa-miR-377	CLIP-seq
MIRT2509076	hsa-miR-380	CLIP-seq
MIRT2205806	hsa-miR-381	CLIP-seq
MIRT2509077	hsa-miR-3913-3p	CLIP-seq
MIRT2436470	hsa-miR-3925-3p	CLIP-seq
MIRT2509078	hsa-miR-410	CLIP-seq
MIRT2509079	hsa-miR-4257	CLIP-seq
MIRT1969714	hsa-miR-4269	CLIP-seq
MIRT1969715	hsa-miR-4279	CLIP-seq
MIRT2509080	hsa-miR-429	CLIP-seq
MIRT2436471	hsa-miR-4290	CLIP-seq
MIRT909941	hsa-miR-431	CLIP-seq
MIRT1969716	hsa-miR-4324	CLIP-seq
MIRT1969717	hsa-miR-4325	CLIP-seq
MIRT2509081	hsa-miR-4421	CLIP-seq
MIRT909943	hsa-miR-4427	CLIP-seq
MIRT909944	hsa-miR-4430	CLIP-seq
MIRT2509082	hsa-miR-4432	CLIP-seq
MIRT2509083	hsa-miR-4434	CLIP-seq
MIRT1969718	hsa-miR-4436b-3p	CLIP-seq
MIRT909946	hsa-miR-4438	CLIP-seq
MIRT1969720	hsa-miR-4464	CLIP-seq
MIRT909947	hsa-miR-4466	CLIP-seq
MIRT909948	hsa-miR-4499	CLIP-seq
MIRT2509084	hsa-miR-449a	CLIP-seq
MIRT2509085	hsa-miR-449b	CLIP-seq
MIRT2509086	hsa-miR-4516	CLIP-seq
MIRT1969721	hsa-miR-4525	CLIP-seq
MIRT2509087	hsa-miR-4531	CLIP-seq
MIRT2205810	hsa-miR-4637	CLIP-seq
MIRT909949	hsa-miR-4638-5p	CLIP-seq
MIRT2205811	hsa-miR-4651	CLIP-seq
MIRT1969722	hsa-miR-4665-5p	CLIP-seq
MIRT909951	hsa-miR-4666-3p	CLIP-seq
MIRT2436472	hsa-miR-4687-5p	CLIP-seq
MIRT1969724	hsa-miR-4695-5p	CLIP-seq
MIRT1969725	hsa-miR-4718	CLIP-seq
MIRT1969726	hsa-miR-4722-3p	CLIP-seq
MIRT1969727	hsa-miR-4723-5p	CLIP-seq
MIRT1969728	hsa-miR-4731-3p	CLIP-seq
MIRT2509088	hsa-miR-4735-5p	CLIP-seq
MIRT1969729	hsa-miR-4740-3p	CLIP-seq
MIRT1969730	hsa-miR-4748	CLIP-seq
MIRT909955	hsa-miR-4759	CLIP-seq
MIRT2509089	hsa-miR-4760-3p	CLIP-seq
MIRT909956	hsa-miR-4762-3p	CLIP-seq
MIRT2509090	hsa-miR-4775	CLIP-seq
MIRT2205812	hsa-miR-4787-5p	CLIP-seq
MIRT2205813	hsa-miR-4789-5p	CLIP-seq
MIRT1969731	hsa-miR-4801	CLIP-seq
MIRT2509091	hsa-miR-483-3p	CLIP-seq
MIRT909960	hsa-miR-484	CLIP-seq
MIRT2509092	hsa-miR-489	CLIP-seq
MIRT2509093	hsa-miR-499-5p	CLIP-seq
MIRT1969732	hsa-miR-507	CLIP-seq
MIRT909961	hsa-miR-5095	CLIP-seq
MIRT909963	hsa-miR-513a-5p	CLIP-seq
MIRT2509094	hsa-miR-516b	CLIP-seq
MIRT2509095	hsa-miR-520a-5p	CLIP-seq
MIRT2509096	hsa-miR-525-5p	CLIP-seq
MIRT1969734	hsa-miR-539	CLIP-seq
MIRT1969735	hsa-miR-552	CLIP-seq
MIRT1969736	hsa-miR-557	CLIP-seq
MIRT2509097	hsa-miR-568	CLIP-seq
MIRT2509098	hsa-miR-584	CLIP-seq
MIRT2509099	hsa-miR-590-3p	CLIP-seq
MIRT2205819	hsa-miR-608	CLIP-seq
MIRT909970	hsa-miR-622	CLIP-seq
MIRT1969740	hsa-miR-625	CLIP-seq
MIRT909971	hsa-miR-627	CLIP-seq
MIRT1969741	hsa-miR-650	CLIP-seq
MIRT909973	hsa-miR-675	CLIP-seq
MIRT909974	hsa-miR-767-5p	CLIP-seq
MIRT909975	hsa-miR-874	CLIP-seq
MIRT909978	hsa-miR-924	CLIP-seq
MIRT2678660	hsa-miR-105	CLIP-seq
MIRT1969685	hsa-miR-10a	CLIP-seq
MIRT1969686	hsa-miR-10b	CLIP-seq
MIRT909903	hsa-miR-1237	CLIP-seq
MIRT909904	hsa-miR-1258	CLIP-seq
MIRT1969687	hsa-miR-126	CLIP-seq
MIRT909905	hsa-miR-1273e	CLIP-seq
MIRT1969688	hsa-miR-1275	CLIP-seq
MIRT2509060	hsa-miR-1281	CLIP-seq
MIRT909906	hsa-miR-1287	CLIP-seq
MIRT1969689	hsa-miR-1291	CLIP-seq
MIRT909907	hsa-miR-1307	CLIP-seq
MIRT2205802	hsa-miR-132	CLIP-seq
MIRT909908	hsa-miR-141	CLIP-seq
MIRT1969691	hsa-miR-145	CLIP-seq
MIRT909909	hsa-miR-146b-3p	CLIP-seq
MIRT1969692	hsa-miR-186	CLIP-seq
MIRT909912	hsa-miR-188-5p	CLIP-seq
MIRT2205803	hsa-miR-191	CLIP-seq
MIRT1969693	hsa-miR-1915	CLIP-seq
MIRT1969694	hsa-miR-192	CLIP-seq
MIRT909913	hsa-miR-194	CLIP-seq
MIRT1969695	hsa-miR-1976	CLIP-seq
MIRT909914	hsa-miR-200a	CLIP-seq
MIRT2509062	hsa-miR-200b	CLIP-seq
MIRT2509063	hsa-miR-200c	CLIP-seq
MIRT2509064	hsa-miR-2054	CLIP-seq
MIRT2509065	hsa-miR-208a	CLIP-seq
MIRT2509066	hsa-miR-208b	CLIP-seq
MIRT2205804	hsa-miR-212	CLIP-seq
MIRT1969696	hsa-miR-215	CLIP-seq
MIRT909918	hsa-miR-22	CLIP-seq
MIRT1969697	hsa-miR-2467-3p	CLIP-seq
MIRT2205805	hsa-miR-300	CLIP-seq
MIRT1969698	hsa-miR-3064-5p	CLIP-seq
MIRT2509067	hsa-miR-3074-3p	CLIP-seq
MIRT1969699	hsa-miR-31	CLIP-seq
MIRT909923	hsa-miR-3117-3p	CLIP-seq
MIRT1969700	hsa-miR-3135b	CLIP-seq
MIRT1969701	hsa-miR-3140-5p	CLIP-seq
MIRT1969702	hsa-miR-3154	CLIP-seq
MIRT909924	hsa-miR-3155	CLIP-seq
MIRT909925	hsa-miR-3155b	CLIP-seq
MIRT909926	hsa-miR-3157-3p	CLIP-seq
MIRT2509068	hsa-miR-3162-3p	CLIP-seq
MIRT909927	hsa-miR-3169	CLIP-seq
MIRT1969703	hsa-miR-3173-3p	CLIP-seq
MIRT909929	hsa-miR-3173-5p	CLIP-seq
MIRT2509069	hsa-miR-3180-5p	CLIP-seq
MIRT909931	hsa-miR-3192	CLIP-seq
MIRT1969704	hsa-miR-328	CLIP-seq
MIRT909932	hsa-miR-329	CLIP-seq
MIRT909933	hsa-miR-339-5p	CLIP-seq
MIRT1969706	hsa-miR-3612	CLIP-seq
MIRT2509073	hsa-miR-361-5p	CLIP-seq
MIRT1969707	hsa-miR-3616-3p	CLIP-seq
MIRT1969708	hsa-miR-3622a-5p	CLIP-seq
MIRT909935	hsa-miR-3652	CLIP-seq
MIRT2509074	hsa-miR-3667-3p	CLIP-seq
MIRT1969711	hsa-miR-3682-5p	CLIP-seq
MIRT1969712	hsa-miR-3692	CLIP-seq
MIRT909937	hsa-miR-370	CLIP-seq
MIRT909940	hsa-miR-377	CLIP-seq
MIRT2509076	hsa-miR-380	CLIP-seq
MIRT2205806	hsa-miR-381	CLIP-seq
MIRT2436470	hsa-miR-3925-3p	CLIP-seq
MIRT2509078	hsa-miR-410	CLIP-seq
MIRT2509079	hsa-miR-4257	CLIP-seq
MIRT2678661	hsa-miR-4266	CLIP-seq
MIRT1969714	hsa-miR-4269	CLIP-seq
MIRT1969715	hsa-miR-4279	CLIP-seq
MIRT2509080	hsa-miR-429	CLIP-seq
MIRT2436471	hsa-miR-4290	CLIP-seq
MIRT909941	hsa-miR-431	CLIP-seq
MIRT1969716	hsa-miR-4324	CLIP-seq
MIRT1969717	hsa-miR-4325	CLIP-seq
MIRT2509081	hsa-miR-4421	CLIP-seq
MIRT909943	hsa-miR-4427	CLIP-seq
MIRT909944	hsa-miR-4430	CLIP-seq
MIRT2509082	hsa-miR-4432	CLIP-seq
MIRT2509083	hsa-miR-4434	CLIP-seq
MIRT1969718	hsa-miR-4436b-3p	CLIP-seq
MIRT909946	hsa-miR-4438	CLIP-seq
MIRT1969720	hsa-miR-4464	CLIP-seq
MIRT909947	hsa-miR-4466	CLIP-seq
MIRT2509086	hsa-miR-4516	CLIP-seq
MIRT1969721	hsa-miR-4525	CLIP-seq
MIRT2509087	hsa-miR-4531	CLIP-seq
MIRT2205810	hsa-miR-4637	CLIP-seq
MIRT909949	hsa-miR-4638-5p	CLIP-seq
MIRT2205811	hsa-miR-4651	CLIP-seq
MIRT1969722	hsa-miR-4665-5p	CLIP-seq
MIRT909951	hsa-miR-4666-3p	CLIP-seq
MIRT1969723	hsa-miR-4687-3p	CLIP-seq
MIRT2436472	hsa-miR-4687-5p	CLIP-seq
MIRT1969724	hsa-miR-4695-5p	CLIP-seq
MIRT1969725	hsa-miR-4718	CLIP-seq
MIRT1969726	hsa-miR-4722-3p	CLIP-seq
MIRT1969727	hsa-miR-4723-5p	CLIP-seq
MIRT1969728	hsa-miR-4731-3p	CLIP-seq
MIRT1969729	hsa-miR-4740-3p	CLIP-seq
MIRT1969730	hsa-miR-4748	CLIP-seq
MIRT909955	hsa-miR-4759	CLIP-seq
MIRT2509089	hsa-miR-4760-3p	CLIP-seq
MIRT909956	hsa-miR-4762-3p	CLIP-seq
MIRT2678662	hsa-miR-4779	CLIP-seq
MIRT2205812	hsa-miR-4787-5p	CLIP-seq
MIRT2205813	hsa-miR-4789-5p	CLIP-seq
MIRT1969731	hsa-miR-4801	CLIP-seq
MIRT2509091	hsa-miR-483-3p	CLIP-seq
MIRT909960	hsa-miR-484	CLIP-seq
MIRT2509093	hsa-miR-499-5p	CLIP-seq
MIRT1969732	hsa-miR-507	CLIP-seq
MIRT909961	hsa-miR-5095	CLIP-seq
MIRT909963	hsa-miR-513a-5p	CLIP-seq
MIRT2509094	hsa-miR-516b	CLIP-seq
MIRT2509095	hsa-miR-520a-5p	CLIP-seq
MIRT2509096	hsa-miR-525-5p	CLIP-seq
MIRT1969734	hsa-miR-539	CLIP-seq
MIRT2205815	hsa-miR-548aa	CLIP-seq
MIRT1969735	hsa-miR-552	CLIP-seq
MIRT1969736	hsa-miR-557	CLIP-seq
MIRT2205818	hsa-miR-570	CLIP-seq
MIRT2509098	hsa-miR-584	CLIP-seq
MIRT2205819	hsa-miR-608	CLIP-seq
MIRT909970	hsa-miR-622	CLIP-seq
MIRT1969740	hsa-miR-625	CLIP-seq
MIRT909971	hsa-miR-627	CLIP-seq
MIRT1969741	hsa-miR-650	CLIP-seq
MIRT909973	hsa-miR-675	CLIP-seq
MIRT909974	hsa-miR-767-5p	CLIP-seq
MIRT909975	hsa-miR-874	CLIP-seq
MIRT909976	hsa-miR-892b	CLIP-seq
MIRT909978	hsa-miR-924	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001764	Process	Neuron migration	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0001878	Process	Response to yeast	IEA
GO:0002685	Process	Regulation of leukocyte migration	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005159	Function	Insulin-like growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	7561682, 8524328, 8626543, 9472046, 9546424, 9788432, 10733900, 11316748, 12384576, 12799422, 12878163, 14657239, 15886098, 16189514, 16273093, 16713569, 17038317, 17474147, 17515907, 18722344, 19001122, 19004829, 19380743, 19447967, 20534451, 21044950, 21988832, 23275563, 24658140
GO:0005634	Component	Nucleus	TAS	10748058
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IC	11870224
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	10748058
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IBA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0008092	Function	Cytoskeletal protein binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008360	Process	Regulation of cell shape	IMP	17515907, 31311869
GO:0009966	Process	Regulation of signal transduction	IDA	17515907
GO:0014911	Process	Positive regulation of smooth muscle cell migration	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016358	Process	Dendrite development	IEA
GO:0016477	Process	Cell migration	IBA
GO:0017124	Function	SH3 domain binding	IPI	12384576
GO:0019899	Function	Enzyme binding	IEA
GO:0019900	Function	Kinase binding	IPI	18722344
GO:0019904	Function	Protein domain specific binding	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030010	Process	Establishment of cell polarity	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	31311869
GO:0030159	Function	Signaling receptor complex adaptor activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IDA	17515907
GO:0030674	Function	Protein-macromolecule adaptor activity	IEA
GO:0030971	Function	Receptor tyrosine kinase binding	IBA
GO:0031594	Component	Neuromuscular junction	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	11870224
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032991	Component	Protein-containing complex	IPI	12384576
GO:0033628	Process	Regulation of cell adhesion mediated by integrin	IEA
GO:0035020	Process	Regulation of Rac protein signal transduction	IEA
GO:0035022	Process	Positive regulation of Rac protein signal transduction	IEA
GO:0035591	Function	Signaling adaptor activity	IBA
GO:0035591	Function	Signaling adaptor activity	IDA	12384576, 17515907
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0035685	Process	Helper T cell diapedesis	IEA
GO:0035728	Process	Response to hepatocyte growth factor	IEA
GO:0038026	Process	Reelin-mediated signaling pathway	IEA
GO:0042169	Function	SH2 domain binding	IPI	9472046
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0043087	Process	Regulation of GTPase activity	IDA	11870224
GO:0045309	Function	Protein phosphorylated amino acid binding	IDA	12384576
GO:0045309	Function	Protein phosphorylated amino acid binding	IEA
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046875	Function	Ephrin receptor binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	11870224
GO:0048013	Process	Ephrin receptor signaling pathway	IDA	11870224
GO:0050773	Process	Regulation of dendrite development	IEA
GO:0060326	Process	Cell chemotaxis	IEA
GO:0061041	Process	Regulation of wound healing	IDA	17515907
GO:0061045	Process	Negative regulation of wound healing	IDA	17515907
GO:0061045	Process	Negative regulation of wound healing	IMP	17515907
GO:0061847	Process	Response to cholecystokinin	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEA
GO:0071732	Process	Cellular response to nitric oxide	IEA
GO:0072657	Process	Protein localization to membrane	IEA
GO:0097110	Function	Scaffold protein binding	IEA
GO:0098698	Process	Postsynaptic specialization assembly	IEA
GO:0098749	Process	Cerebellar neuron development	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IEA
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IMP	19004829
GO:1901652	Process	Response to peptide	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IDA	12384576
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1904395	Process	Positive regulation of skeletal muscle acetylcholine-gated channel clustering	IEA
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IEA
GO:1990782	Function	Protein tyrosine kinase binding	IPI	12384576
GO:1990859	Process	Cellular response to endothelin	IEA
GO:2000145	Process	Regulation of cell motility	IDA	17515907
GO:2000145	Process	Regulation of cell motility	IEA
GO:2000146	Process	Negative regulation of cell motility	IDA	17515907
GO:2000146	Process	Negative regulation of cell motility	IMP	17515907
GO:2000404	Process	Regulation of T cell migration	IEA

Other IDs

• MIM: 164762
• HGNC: 2362
• e!Ensembl: ENSG00000167193

Protein

• UniProt ID: P46108
• Protein name: Adapter molecule crk (Proto-oncogene c-Crk) (p38)
• Protein function: Involved in cell branching and adhesion mediated by BCAR1-CRK-RAPGEF1 signaling and activation of RAP1. ; [Isoform Crk-II]: Regulates cell adhesion, spreading and migration (PubMed:31311869). Mediates atta
• PDB: 1JU5, 2DVJ, 2EYV, 2EYW, 2EYX, 2EYY, 2EYZ, 2MS4, 5UL6, 6ATV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	13 → 104	SH2 domain	Domain
  PF00018	SH3_1	138 → 184	SH3 domain	Domain
  PF07653	SH3_2	239 → 294	Variant SH3 domain	Domain

• Sequence:

  MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
  IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
  SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
  MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
  RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
  EDFS

• Sequence length: 304

Pathways

KEGG:

MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Efferocytosis
Focal adhesion
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Growth hormone synthesis, secretion and action
Bacterial invasion of epithelial cells
Shigellosis
Yersinia infection
Human cytomegalovirus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Chronic myeloid leukemia

Reactome:

ARMS-mediated activation
Downstream signal transduction
Regulation of actin dynamics for phagocytic cup formation
p130Cas linkage to MAPK signaling for integrins
VEGFA-VEGFR2 Pathway
PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
MET activates RAP1 and RAC1
MET receptor recycling
Regulation of signaling by CBL
FCGR3A-mediated phagocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acanthosis Nigricans	Acanthosis Nigricans	BEFREE	22585574		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	29298652		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29349553, 29484391, 29890468, 30718368, 31432106		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11585739, 24356912, 27775076, 30879017		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	12970743, 21164364, 21858220, 22415779, 28900489, 30321617, 30827261, 30879017		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15969750, 17078869		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28114280		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	30298517		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	17950728		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28194256		★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	30940726		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30233281		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30033276		★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	28493082, 29282578, 31429590		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	28273913, 29499331, 29789529		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28566491, 29366902, 31378753		★☆☆☆☆ Found in Text Mining only
Anemia, Diamond-Blackfan	Anemia	BEFREE	25270909		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31447579		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	31456484		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25426613		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	31398429		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30905780		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	28437005		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17363696, 17957039, 21695272, 27592629, 27871059, 29257205, 29378168, 29566026, 29692651, 29793330, 30486366, 31171272, 31496351		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16043718, 18026701, 22488549, 24107108, 28343998, 29206314		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29973208	Associate	★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	28948356		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	14991070		★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	18314537		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	BEFREE	31014201		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	12641490, 26517722, 28402030, 29284473, 29448086, 29554934, 30186353, 30428724, 30511684, 30589094, 31445014, 31602218, 31808595		★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	BEFREE	30244166		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12191496, 17446059		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24252689	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17363696, 17957039, 21695272, 27592629, 27871059, 29257205, 29378168, 29566026, 29692651, 29793330, 30486366, 31171272, 31496351		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23813913	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30297392		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	23035971	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23139385, 23190644, 24741615		★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	28493082, 29282578, 31429590		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	15753397, 21092277, 24738081, 28158919, 28272166, 28713946, 28849038, 29725459, 30106096, 30106128, 30335886, 30368882, 30426692, 30944654		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15483673		★☆☆☆☆ Found in Text Mining only
Barber Say syndrome	Barber Say Syndrome	BEFREE	22585574		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31464618		★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	22585574		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	beta Thalassemia	BEFREE	31789406		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	31789406		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	31078518		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	19293182, 21902544, 22154358, 29463565, 31141251		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22425892, 29637005		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	29382550		★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	18058803		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10766865, 12698197, 12972603, 15056732, 17214981, 17697330, 17875734, 19279008, 19920204, 20980434, 21099351, 22064321, 22073986, 22157753, 22569336, 22579953, 22825349, 23900300, 24098377, 24464183, 24722482, 25066918, 25141981, 25189770, 25384584, 25727011, 25828376, 26716512, 27292262, 27876502, 28160858, 28276317, 28393288, 28560951, 28681938, 28718669, 28861172, 30352570, 30391782, 30447427, 30634506, 31513357, 31784750		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12006644, 15831672	Associate	★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	22585574		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22383989	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19293182, 21902544, 22154358, 29463565, 31141251		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17609948, 18602365, 19401523, 21164364, 21885439, 22053010, 22415779, 23333461, 26872057, 27026405, 27537399, 27922667, 28460458, 30280780, 30827261, 31428903, 31489665, 31695416		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22384141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16681758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	22302101		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27322208, 30049957, 31301414		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	29506687		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30292134, 31494123, 31689891		★☆☆☆☆ Found in Text Mining only
Cerebral Cavernous Malformations 3	Cerebral Cavernous Malformation	BEFREE	19246713		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30503674		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29382550		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23940799, 30098789		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23940799, 30098789		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	12717393, 16469407, 23024367, 25502636		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	16639284		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16549373, 18340449, 21328612, 26168133		★☆☆☆☆ Found in Text Mining only
Chronic Infantile Neurological, Cutaneous, and Articular Syndrome	Neurological, Cutaneous And Articular Syndrome	BEFREE	16279571		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27226108, 30897126		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15483673, 16408101, 18288129, 26337206		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28237966		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	17406066, 28214201, 28621371, 29074542, 29566026, 29719383, 30588579		★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	12621583, 37510238	Associate	★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Lissencephaly	Pubtator	39513527	Inhibit	★☆☆☆☆ Found in Text Mining only
Classical phenylketonuria	Phenylketonuria	BEFREE	19946178		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29467361, 30609815		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16838116, 25533544, 31205031		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15037631, 16849586, 21847367, 22076613, 22684547, 23422270, 23859040, 24880666, 29636389, 31364822		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25890501		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10769637, 15975962, 20413844, 23900560, 28376477, 28731192, 28864417, 30211553, 30221676, 30588113, 30864690, 30949407, 31650548		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18392556, 29693170	Associate	★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	21876345		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28049487		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11448140, 11593045, 15867183, 19357768, 21271996, 28100897, 28104751, 30860934, 31505169		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20307495		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29122645		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	22585574, 30804419		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12223450, 25533544		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20460375		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	18031579, 18223264, 18523305, 20155832, 21181091, 25091567, 26873249, 27907835, 28337303, 28744712, 29061447, 29524442, 29682561, 29899528, 31210280, 31308631, 31760158, 31831024		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	24455679		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	21810259, 29867510, 31629950		★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29535261		★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	28493082, 29282578		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25912722		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	21288594, 29621941		★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	29088769		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12957654, 17554073, 28534138, 31794124		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12957654, 17554073, 21478266, 28534138, 28807219, 29523003, 29615288, 31794124		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28761062	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26911458		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17922475, 21892182, 25758573, 28888936, 29663930, 30284474, 30981822, 31072439, 31473185		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	30067872		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27226108, 28588674, 28672912, 30049003, 30784180		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	22605924		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30446590		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	25748067	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	29721975		★☆☆☆☆ Found in Text Mining only
Duodenal Ulcer	Duodenal Ulcer	BEFREE	30119655		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26033187		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25912722		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	26153023		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15550066, 24923883, 26394174, 28845752, 30773096		★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	20885979		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16792588		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	39513527	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	20833799		★☆☆☆☆ Found in Text Mining only
EPILEPSY, PYRIDOXINE-DEPENDENT	Epilepsy	BEFREE	19801633		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28472735		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	28188686, 30868916		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30049957		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	29344159		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	29344159		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25502636		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	28493083		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	22234699		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	28539126		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP F	Fanconi Anemia	BEFREE	22952942		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	30205811, 30914267		★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	16753021		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	29104242		★☆☆☆☆ Found in Text Mining only
Fibrosis of pancreas	Fibrosis Of Pancreas	BEFREE	29705706		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23459070, 29322133, 30700848		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	28483380		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	29568068		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	29568068		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	29217619, 31751591		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	25748067	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	26312487		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	BEFREE	26312487		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12727859, 22528800, 22901381, 23261467, 24185179, 25088200, 26597532, 26794430, 28012022, 28386317, 29088769, 29316898, 29669288, 30359578, 30639532, 30717309, 31143512, 31295040, 31673920, 31719901		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17825249		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24252689	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26473374, 33561443	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12727859, 22528800, 22901381, 23261467, 25088200, 26597532, 26794430, 28012022, 28386317, 29088769, 29316898, 29669288, 30359578, 30639532, 30717309, 31143512, 31295040, 31673920, 31719901		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10595738, 17406030, 22114076, 27609291, 28012022, 28569417, 29316898, 30674294, 30678338		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10595738, 26473374	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28483380		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	39513527	Associate	★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	31548323		★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome, Familial	Guillain-Barre Syndrome	BEFREE	31548323		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	23837874		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22110204, 29983416		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11448140, 11593045, 15867183, 19357768, 21271996, 28104751, 31505169		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	25583406		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	22244889		★☆☆☆☆ Found in Text Mining only
Hemolytic-Uremic Syndrome	Hemolytic Uremic Syndrome	BEFREE	31130074		★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	BEFREE	16786433		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	26660341		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18327563		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12107734, 12957654, 24720336, 25758573, 26439801, 28731135, 28962618, 29421811, 31150695, 9916130		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30651770		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	28185107		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	14561851, 27283322, 29566148		★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	28471037		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28910144, 30274147		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30074215		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30897126		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	28553779		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30302660		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27283322, 28472735, 29201176, 29467361, 29804103, 30609815, 30695686, 30845718		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	28601021		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16838116		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29535261, 31378305		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	20661932, 26911458		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	26911458		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	28241849		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28500782		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29663930, 31115561		★☆☆☆☆ Found in Text Mining only
Jaundice, Obstructive	Jaundice	BEFREE	31810142		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	18221537		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27226108		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28881633, 29504713, 30511081, 30539653, 30976980, 30991714, 31639165		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28352125		★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	39513527	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15514005, 23707387, 23880928, 25684043, 26205966		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20543580, 25426669		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17950728		★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	22085993		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	22243975, 28882999		★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	BEFREE	12621583, 21876345		★☆☆☆☆ Found in Text Mining only
Lissencephaly	Lissencephaly	Pubtator	12621583	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10445852, 15849811, 17673262, 19497411, 21102517, 21732638, 23029478, 23319057, 24199952, 25230705, 25514221, 25703929, 25874498, 27662474, 28190473, 29159945, 29263422, 29710490, 29716964, 30551534, 30582951, 30850165, 31038073, 31067004, 31076403, 31186732, 31213506, 31649538		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	10445852, 21732638		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12584565, 12970743, 27226640, 28007785, 30867890		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12970743, 18602365		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	30268079		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	30268079		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	30268079		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27365897, 30145800		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	30268079		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	18094073		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29171987	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12082638, 16247482, 22649101, 23153195, 29604597		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	15077178, 26475474		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	15077178, 26475474		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	15077178, 26475474		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	20833799		★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	18362077		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30180869		★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	22243975		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23261452		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22110204, 29983416		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12698197, 12972603, 15056732, 16897432, 17214981, 17697330, 17875734, 19279008, 19920204, 20980434, 21099351, 22064321, 22073986, 22157753, 22569336, 22825349, 24098377, 24464183, 25066918, 25141981, 25189770, 25727011, 25828376, 26716512, 27292262, 27876502, 28160858, 28276317, 28393288, 28560951, 28681938, 28718669, 28861172, 28977919, 30352570, 30391782, 30447427, 30634506, 31513357, 31784750		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23722928, 29344159		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31147803		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12970743, 15138850, 17609948, 18602365, 19401523, 21164364, 21885439, 22053010, 22415779, 23333461, 26872057, 27026405, 27537399, 27922667, 28007785, 28460458, 30280780, 30827261, 31489665, 31695416		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27322208, 31301414		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14598883, 24720336, 26439801, 26479921, 27278736, 29340057		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15031672, 16437387, 16618780, 16956884, 18413810, 23255296, 24080497, 24228091, 24619413, 26913608, 26919443, 28008585, 28213961, 29416632, 29894706, 30250582, 31509289		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	12370831, 30468479		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22383989, 27890795, 29171987, 29237470, 30011079		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25045295		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	19293182, 21902544, 22154358, 29463565, 31141251		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17483345, 18217689, 19852565, 21470196, 21885439, 22106296, 22154358, 22302101, 22522455, 23335506, 23403951, 24030148, 24115572, 24356814, 24366869, 24742967, 24880666, 25456131, 25701783, 27642049, 27680505, 27725227, 28098340, 28460458, 28536142, 28677816, 28731192, 29316898, 29331758, 29495003, 29575240, 29636389, 29704518, 29880481, 29930276, 30013667, 30456845, 30867890, 31266950, 31440466, 31623319, 31828036, 7898918		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23940799, 30098789		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15037631, 16849586, 21847367, 22076613, 22684547, 23422270, 23859040, 24880666, 29636389, 31364822		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19920204, 21099351, 22569336, 24251561		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	27893734		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22302101, 22855790		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10871852, 15378016, 18068334, 18983537, 29067466, 29276966, 29291012, 30873870, 31401046		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29867510, 31629950		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	20833799		★☆☆☆☆ Found in Text Mining only
Muckle-Wells Syndrome	Muckle-Wells Syndrome	BEFREE	16279571		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	18593922, 19282458, 22425892, 23066034, 30583070, 31777580		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21791428		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29723037		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	31189728		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	16272363		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	16204077		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	16204077, 16940419, 22327869, 25480830, 28405919		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	29670085		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	17949234, 19324082, 19672773, 21890458, 28133573		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	28237966		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28559372, 28713990, 29232411, 29434760, 29630131, 29991775, 30116330, 30391964, 31646600		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	20307495		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	BEFREE	31370111		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23406595, 30804419		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20607722, 31436393		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11279018, 12021785, 12970743, 12972603, 14730602, 15492254, 1560527, 15611662, 15976377, 16230412, 1630456, 17108114, 17254968, 17346218, 18245484, 19584293, 19740433, 21164364, 21734453, 21923922, 22006115, 22117196, 22425892, 22610972, 22855790, 22965873, 23212914, 23403951, 23722928, 24045413, 24115572, 24185179, 25141924, 25141981, 25694398, 25890501, 25955299, 26153023, 26475474, 26479921, 26804168, 26913608, 27292262, 27725227, 28178600, 28194179, 28245767, 28460458, 28536142, 28560056, 28887603, 29067466, 29171987, 29288534, 29313726, 29463565, 29620232, 29716964, 30280780, 30328290, 30352570, 30691509, 30867799, 31266950, 31436393, 31535570, 31585897, 9877171		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	29187369		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30983972		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11032891, 11163539, 11598801, 15784962, 15950779, 16484283, 18534018, 19009558, 23507189, 25033461, 25086905, 25148040, 28831692, 30545920		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30327995, 30735722		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	28202578		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30908654		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10874022, 16705311, 21306997, 22053010, 23456625, 24026034, 24292713, 25956913, 26503828, 26799187, 28286419, 28460458, 29110442, 30564960, 30605882, 30771292, 30796972, 30867799, 30867890, 31590176, 31708104		★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	29575791		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24929539, 25034973, 29317435, 31139234, 31553232		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30731111		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19828631, 28343998, 30439432, 30934850		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30934850		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19330880, 22849560, 23262982, 26238193, 27799356, 28350136, 29434992, 29607921, 30267330, 30746754, 31268160, 31505816, 31719210		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27322208, 31301414		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20237902, 37085900	Associate	★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	31554784		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	25655200		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14598883, 24720336, 26439801, 26479921, 27278736, 29340057		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31432106		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25231838, 25592304, 30015845, 30904818		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	12783850, 16049031, 21209210, 28035410, 28365714, 29540778, 29899409, 30071902, 30933849, 30995872		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	28928733		★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	23657501		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	31586635		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	26138525		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28120492, 29207066, 31599069		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31387001		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31387001		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	15698454		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	19946178		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15658002, 15977985		★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	29168690		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	31231308		★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	28344879		★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	26010611		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28295194		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26010611		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15031672, 16618780, 16956884, 18413810, 19242540, 23255296, 24080497, 24228091, 24619413, 26913608, 26919443, 28008585, 28213961, 29416632, 29894706, 30250582, 31509289		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12738793		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	24863062, 28266627, 28602508, 31378305		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	29049722		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27226108, 30082522		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23859041		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	22076433, 26919280, 27365897, 29661023, 30127380, 30897126, 31739543		★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	28948356		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	12819782		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12819782, 29039541		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	12819782		★☆☆☆☆ Found in Text Mining only
Restrictive cardiomyopathy	Restrictive cardiomyopathy	BEFREE	11593045		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29408550		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	31648555		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	14730602, 27642049, 29109039, 29237430, 29790698		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	12186945, 29790086		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12641490, 14730602, 15170913, 15557189, 16778989, 16947383, 17530707, 19765281, 19828631, 22488549, 24574214, 25367151, 25932604, 26420479, 27226108, 27597652, 28339004, 28515692, 29511118, 29943389, 31037574, 31514188, 31736366		★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	28657795		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22243975, 24356912		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28035416		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	11918720, 16098034		★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	30954890		★☆☆☆☆ Found in Text Mining only
Seckel syndrome	Seckel Syndrome	BEFREE	23401567		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15658002, 15977985, 29201176		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28147298, 29039541, 29227823, 31775794		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	17470913		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	31585897		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31309463		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	31078518		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	28887603		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	23656793		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20121928, 31315217		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22167332, 22522455		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21339045	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28469797		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20717005, 22110204, 24568968, 27531877, 28915597, 29575240, 29747487, 30622052		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	29410394		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31331032		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30914267		★☆☆☆☆ Found in Text Mining only
Stevens-Johnson Syndrome Toxic Epidermal Necrolysis Spectrum	Stevens-Johnson Syndrome	BEFREE	28949055		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22383989, 27890795, 29171987, 29237470		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21698158, 22383989, 25027343, 29171987	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29160895, 30242669, 30980845		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	LHGDN	16849525		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	19737974		★☆☆☆☆ Found in Text Mining only
SYNOVITIS, GRANULOMATOUS, WITH UVEITIS AND CRANIAL NEUROPATHIES (disorder)	Arthrocutaneouveal granulomatosis	BEFREE	25429073		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	11918720, 16098034, 28189565, 30404019		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	28194179		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	12581337, 15658002, 15977985		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	31547619		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25045295		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25045295		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28194179		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	28710025		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29777109, 29880481, 30462562		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30928642		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26090671, 28667430, 29518435		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveitis	Uveitis	BEFREE	23401649		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	30158835		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	19207217		★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	19207217		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	30173943		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	16803993, 20536832		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	31889432, 34384283	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	30555679		★☆☆☆☆ Found in Text Mining only