CRHR2 (corticotropin releasing hormone receptor 2)

Gene

• Entrez ID: 1395
• Gene name: Corticotropin releasing hormone receptor 2
• Gene symbol: CRHR2
• Synonyms (NCBI Gene): CRF-RB, CRF2, CRFR2, HM-CRF
• Chromosome: 7
• Chromosome location: 7p14.3
• Summary: The protein encoded by this gene belongs to the G-protein coupled receptor 2 family, and the subfamily of corticotropin releasing hormone receptor. This receptor shows high affinity for corticotropin releasing hormone (CRH), and also binds CRH-related pep

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs7793837	A>C,T	Drug-response	Genic upstream transcript variant, intron variant, 5 prime UTR variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017454	hsa-miR-335-5p	Microarray	18185580
MIRT909564	hsa-miR-1237	CLIP-seq
MIRT909565	hsa-miR-1248	CLIP-seq
MIRT909566	hsa-miR-1285	CLIP-seq
MIRT909567	hsa-miR-19a	CLIP-seq
MIRT909568	hsa-miR-19b	CLIP-seq
MIRT909569	hsa-miR-296-5p	CLIP-seq
MIRT909570	hsa-miR-3134	CLIP-seq
MIRT909571	hsa-miR-3187-5p	CLIP-seq
MIRT909572	hsa-miR-3194-3p	CLIP-seq
MIRT909573	hsa-miR-326	CLIP-seq
MIRT909574	hsa-miR-330-5p	CLIP-seq
MIRT909575	hsa-miR-378g	CLIP-seq
MIRT909576	hsa-miR-4301	CLIP-seq
MIRT909577	hsa-miR-4426	CLIP-seq
MIRT909578	hsa-miR-4486	CLIP-seq
MIRT909579	hsa-miR-4521	CLIP-seq
MIRT909580	hsa-miR-4647	CLIP-seq
MIRT909581	hsa-miR-4662b	CLIP-seq
MIRT909582	hsa-miR-4696	CLIP-seq
MIRT909583	hsa-miR-4764-5p	CLIP-seq
MIRT909584	hsa-miR-483-5p	CLIP-seq
MIRT909585	hsa-miR-612	CLIP-seq
MIRT909586	hsa-miR-767-3p	CLIP-seq
MIRT909587	hsa-miR-942	CLIP-seq
MIRT1969604	hsa-miR-103a	CLIP-seq
MIRT1969605	hsa-miR-107	CLIP-seq
MIRT1969606	hsa-miR-1301	CLIP-seq
MIRT1969607	hsa-miR-4328	CLIP-seq
MIRT1969608	hsa-miR-4684-3p	CLIP-seq
MIRT1969609	hsa-miR-5047	CLIP-seq
MIRT1969610	hsa-miR-548c-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11329063, 20966082, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8536644
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IBA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	8536644
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IBA
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	TAS	9717834
GO:0016020	Component	Membrane	IEA
GO:0017046	Function	Peptide hormone binding	IBA
GO:0030425	Component	Dendrite	IBA
GO:0043404	Function	Corticotropin-releasing hormone receptor activity	IBA
GO:0043679	Component	Axon terminus	IBA
GO:0060291	Process	Long-term synaptic potentiation	IBA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IEA

Other IDs

• MIM: 602034
• HGNC: 2358
• e!Ensembl: ENSG00000106113

Protein

• UniProt ID: Q13324
• Protein name: Corticotropin-releasing factor receptor 2 (CRF-R-2) (CRF-R2) (CRFR-2) (Corticotropin-releasing hormone receptor 2) (CRH-R-2) (CRH-R2)
• Protein function: G-protein coupled receptor for CRH (corticotropin-releasing factor), UCN (urocortin), UCN2 and UCN3. Has high affinity for UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G protei
• PDB: 3N93, 3N95, 3N96, 6PB1, 7TRY, 7TS0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02793	HRM	37 → 101	Hormone receptor domain	Family
  PF00002	7tm_2	113 → 355	7 transmembrane receptor (Secretin family)	Family

• Sequence:

  MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
  ERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
  YLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESN
  EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIV
  AWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
  ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYC
  FFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV

• Sequence length: 411

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Cushing syndrome

Reactome:

Class B/2 (Secretin family receptors)
G alpha (s) signalling events
Synthesis, secretion, and deacylation of Ghrelin
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	23539366		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	21946917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	BEFREE	10223285, 17183713, 17953621, 30979915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	CTD_human_DG	17627984		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	15192151, 16920976, 30979915		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	10742108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	15192151, 16920976, 30979915		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	10742108		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18408560, 22472724		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	18408560		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18408560	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	17532191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	17532191		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	26182893		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19437022	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	16920976		★☆☆☆☆ Found in Text Mining only
CEREBRAL AMYLOID ANGIOPATHY, ITM2B-RELATED, 1	Cerebral Amyloid Angiopathy	BEFREE	23539366		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	18408560		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	27773939	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28550160		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16920976, 29713130		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	23539366, 31882463	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28811708		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24260200, 28929494		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28929494	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28550160, 30584229		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19437022		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	37062723, 37543650	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	31844086	Inhibit	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21360527		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	12832554, 15192151, 17467808, 18843268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	17467808, 31570003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	26808377	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysphoric mood	Mood Disorder	PSYGENET_DG	21946917		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	11526468		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28109061		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19433256, 28109061	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	27567427		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23638035, 27567427		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28550160, 30584229		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	10742107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	30354709, 30565964		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	23539366, 26808377, 31570003		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	26808377	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30739813, 31330967		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	19437022		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	19437022	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16175604, 19813023		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	CTD_human_DG	16855006		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	22665367	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36277017	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	11857585, 22467522, 31582756		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28109061		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20630588, 23821771		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	12832554, 15192151, 17467808, 18843268		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	17467808, 31570003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	11526468		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11857585, 16611089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	11857585, 12832554, 16611089		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	Pubtator	34241624	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	28492284		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28492284		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12843181, 19437022, 28929494		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27773939		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	27773939	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23821771		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	16691126, 22467522, 28435125		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	16691126		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37543650	Associate	★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	31844086		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	24123648, 27550842, 28686326, 31655035		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19058138		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22840887		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19437022		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17976162		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21360527		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18838498		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23539366		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	11857585, 22467522		★☆☆☆☆ Found in Text Mining only