CRHR1 (corticotropin releasing hormone receptor 1)

Gene

• Entrez ID: 1394
• Gene name: Corticotropin releasing hormone receptor 1
• Gene symbol: CRHR1
• Synonyms (NCBI Gene): CRF-R, CRF-R-1, CRF-R1, CRF1, CRFR-1, CRFR1, CRH-R-1, CRH-R1, CRHR, CRHR1L
• Chromosome: 17
• Chromosome location: 17q21.31
• Summary: This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal tr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT909538	hsa-miR-1202	CLIP-seq
MIRT909539	hsa-miR-1275	CLIP-seq
MIRT909540	hsa-miR-1343	CLIP-seq
MIRT909541	hsa-miR-148a	CLIP-seq
MIRT909542	hsa-miR-148b	CLIP-seq
MIRT909543	hsa-miR-152	CLIP-seq
MIRT909544	hsa-miR-3194-5p	CLIP-seq
MIRT909545	hsa-miR-3661	CLIP-seq
MIRT909546	hsa-miR-3945	CLIP-seq
MIRT909547	hsa-miR-3972	CLIP-seq
MIRT909548	hsa-miR-4253	CLIP-seq
MIRT909549	hsa-miR-4268	CLIP-seq
MIRT909550	hsa-miR-4448	CLIP-seq
MIRT909551	hsa-miR-4481	CLIP-seq
MIRT909552	hsa-miR-4525	CLIP-seq
MIRT909553	hsa-miR-4665-5p	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT909555	hsa-miR-4722-3p	CLIP-seq
MIRT909556	hsa-miR-4723-5p	CLIP-seq
MIRT909557	hsa-miR-4745-5p	CLIP-seq
MIRT909558	hsa-miR-625	CLIP-seq
MIRT909559	hsa-miR-631	CLIP-seq
MIRT909560	hsa-miR-637	CLIP-seq
MIRT909561	hsa-miR-3126-5p	CLIP-seq
MIRT909562	hsa-miR-432	CLIP-seq
MIRT909563	hsa-miR-4443	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT909538	hsa-miR-1202	CLIP-seq
MIRT909539	hsa-miR-1275	CLIP-seq
MIRT909540	hsa-miR-1343	CLIP-seq
MIRT909541	hsa-miR-148a	CLIP-seq
MIRT909542	hsa-miR-148b	CLIP-seq
MIRT909543	hsa-miR-152	CLIP-seq
MIRT909544	hsa-miR-3194-5p	CLIP-seq
MIRT909546	hsa-miR-3945	CLIP-seq
MIRT909547	hsa-miR-3972	CLIP-seq
MIRT909548	hsa-miR-4253	CLIP-seq
MIRT909549	hsa-miR-4268	CLIP-seq
MIRT909550	hsa-miR-4448	CLIP-seq
MIRT909551	hsa-miR-4481	CLIP-seq
MIRT909552	hsa-miR-4525	CLIP-seq
MIRT909553	hsa-miR-4665-5p	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT909556	hsa-miR-4723-5p	CLIP-seq
MIRT909557	hsa-miR-4745-5p	CLIP-seq
MIRT909558	hsa-miR-625	CLIP-seq
MIRT909560	hsa-miR-637	CLIP-seq
MIRT1969596	hsa-miR-1256	CLIP-seq
MIRT1969597	hsa-miR-138	CLIP-seq
MIRT1969598	hsa-miR-34a	CLIP-seq
MIRT1969599	hsa-miR-34c-5p	CLIP-seq
MIRT1969600	hsa-miR-4456	CLIP-seq
MIRT1969601	hsa-miR-449a	CLIP-seq
MIRT1969602	hsa-miR-449b	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT1969603	hsa-miR-4761-3p	CLIP-seq
MIRT2205741	hsa-miR-3189-5p	CLIP-seq
MIRT909554	hsa-miR-4691-3p	CLIP-seq
MIRT2205742	hsa-miR-4758-3p	CLIP-seq
MIRT2447620	hsa-miR-3125	CLIP-seq
MIRT2447621	hsa-miR-3689d	CLIP-seq
MIRT2447622	hsa-miR-3916	CLIP-seq
MIRT2447623	hsa-miR-4459	CLIP-seq
MIRT2447624	hsa-miR-4722-5p	CLIP-seq
MIRT2447625	hsa-miR-583	CLIP-seq
MIRT2508816	hsa-miR-1910	CLIP-seq
MIRT2508817	hsa-miR-3164	CLIP-seq
MIRT2508818	hsa-miR-486-5p	CLIP-seq
MIRT2508816	hsa-miR-1910	CLIP-seq
MIRT2508817	hsa-miR-3164	CLIP-seq
MIRT2508818	hsa-miR-486-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	20233629
RELA	Activation	20233629

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IMP	23863939
GO:0005515	Function	Protein binding	IPI	18801728, 20966082, 26352593, 30126976
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18292205
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7692441, 10598591
GO:0006955	Process	Immune response	TAS	7692441
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	18292205
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	10598591
GO:0007565	Process	Female pregnancy	NAS	7585095
GO:0007567	Process	Parturition	TAS	10598591
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IEA
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IBA
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IDA	18292205
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	IEA
GO:0015056	Function	Corticotrophin-releasing factor receptor activity	TAS	10598591
GO:0016020	Component	Membrane	IDA	23863939
GO:0016020	Component	Membrane	IEA
GO:0030325	Process	Adrenal gland development	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0035640	Process	Exploration behavior	IEA
GO:0042596	Process	Fear response	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043404	Function	Corticotropin-releasing hormone receptor activity	IBA
GO:0048149	Process	Behavioral response to ethanol	IEA
GO:0051049	Process	Regulation of transport	IEA
GO:0051424	Function	Corticotropin-releasing hormone binding	IBA
GO:0051458	Process	Corticotropin secretion	IEA
GO:0051458	Process	Corticotropin secretion	ISS
GO:0051867	Process	General adaptation syndrome, behavioral process	IEA
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IDA	18292205
GO:0071376	Process	Cellular response to corticotropin-releasing hormone stimulus	IEA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1901386	Process	Negative regulation of voltage-gated calcium channel activity	IDA	18292205
GO:2000852	Process	Regulation of corticosterone secretion	IEA
GO:2000852	Process	Regulation of corticosterone secretion	ISS

Other IDs

• MIM: 122561
• HGNC: 2357
• e!Ensembl: ENSG00000120088

Protein

• UniProt ID: P34998
• Protein name: Corticotropin-releasing factor receptor 1 (CRF-R-1) (CRF-R1) (CRFR-1) (Corticotropin-releasing hormone receptor 1) (CRH-R-1) (CRH-R1)
• Protein function: G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins)
• PDB: 2L27, 3EHS, 3EHT, 3EHU, 4K5Y, 4Z9G, 6P9X, 6PB0, 8GTG, 8GTI, 8GTM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02793	HRM	41 → 105	Hormone receptor domain	Family
  PF00002	7tm_2	168 → 388	7 transmembrane receptor (Secretin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe. {ECO:0000269|PubMed:8243652}.
• Sequence:

  MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
  GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
  IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
  NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
  YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
  YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
  VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
  ARAMSIPTSPTRVSFHSIKQSTAV

• Sequence length: 444

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Long-term depression
Cushing syndrome

Reactome:

Class B/2 (Secretin family receptors)
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONTACT DERMATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRHR1-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, CONTACT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS OF HIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	9745449		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18565889		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11861501		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12843181, 9745449		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18565889		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	GWASDB_DG	22693459		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37354922	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	30386171		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	25697705		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	21917807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	PSYGENET_DG	21917807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	CTD_human_DG	16420149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety Disorder	BEFREE	15192151, 15310462, 15365580, 22249355, 22573456, 23274505, 29477954, 30248435, 30447186, 30499109, 30979915, 31698409		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	18801728, 23274505, 26643280, 26923505, 31908177	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	15192151, 15310462, 15365580, 16806114, 20383137, 22249355, 22573456, 23274505, 26324098, 28233670, 29477954, 30248435, 30447186, 30499109, 30979915, 31698409		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	19596121, 25059547, 26923505	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	22231481, 9299637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	22231481, 9299637		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	22089831	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15128701, 18622266, 19210659, 27003716		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	18622266, 19409562	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorder	Autism	Pubtator	37907504	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	22341483, 23962971, 24012103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22341483, 23068076, 23962971, 24012103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	26182893		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26138318		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31908177	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	30467342, 30733615		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30467342	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	28833350		★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	BEFREE	29315139		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18565889		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19663668		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	23478074		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25015995, 29115460		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	22948128	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	25422957	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27754786		★☆☆☆☆ Found in Text Mining only
Constipation	Constipation	Pubtator	22957021	Associate	★☆☆☆☆ Found in Text Mining only
Contact Dermatitis	Dermatitis	CTD_human_DG	12631246		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Crohn Disease	Crohn disease	Pubtator	21383526	Stimulate	★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	37543650	Associate	★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	31844086	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	21360527		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29115460		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15310462, 15365580, 16122764, 17376150, 17585962, 18250257, 19220485, 19548263, 19596121, 19736354, 20383137, 20957648, 21998007, 22573456, 22748421, 22957021, 23157339, 23726670, 24166410, 24741566, 24931706, 24933348, 25422957, 25422958, 25802844, 26206446, 26518448, 28183242, 28461011, 29080675, 29317606, 30499109, 31737064, 31784962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	18250257, 18801728, 19220485, 19596121, 21438878, 22957021, 25059547, 26518448, 31908177, 32305063	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	24867333, 24931706, 24933348, 25422957, 25422958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis Atopic	Atopic dermatitis	Pubtator	22360979	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22000570		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	22957021	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	11526468, 28833350		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22000570		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19433256	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21289256, 23638035, 30427841		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	22573456		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	27899424		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	27899424	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29805572		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27754786		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	27754786	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18496130, 30354709		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28750017, 31199033		★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	23123321, 25954915, 27534449		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	21106875		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28240194		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	23529111		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	23529111		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22957021, 26808377, 27497153, 28240194		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22957021, 26808377, 27497153	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31715260		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28823817, 29776484, 31330967		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	22089831	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	27497153		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	21998007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	16122764, 16815632, 17258395, 19844206, 22194899, 22249355, 22378896, 22467522, 23157339, 23529111, 23962971, 26271720, 27544317, 27549215, 31582756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22249355, 22467522, 23157339, 23529111, 23962971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	CTD_human_DG	23529111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	26138318		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12843181, 25015995, 25960164, 28618089		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20630588, 23821771		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	29915430		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	23068076		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10536983, 16245303	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15310462, 15365580, 16122764, 17376150, 17585962, 18250257, 19220485, 19548263, 19596121, 19736354, 20383137, 20957648, 21998007, 22573456, 22748421, 22957021, 23157339, 24166410, 24741566, 24931706, 24933348, 25422957, 25422958, 25802844, 26206446, 26518448, 28183242, 28461011, 29080675, 29317606, 30499109, 31737064, 31784962		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	24867333, 24931706, 24933348, 25422957, 25422958		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	20010888, 21810631, 26518448, 27894002, 30447186, 31344440		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	11526468, 28823817, 29772307, 30124114, 30427333		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16611089, 17363685, 23962971, 24012103, 29755375, 30499109		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16611089, 17363685, 23147386, 23962971, 24012103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20699326		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	28492284		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28492284		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12843181, 16837614, 21383526, 23821771, 25015995, 28423358, 9745449		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25960164		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30427333		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	28433457		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24166410, 24933348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	24166410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	34872017	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23821771		★☆☆☆☆ Found in Text Mining only
Osteoarthritis Hip	Osteoarthritis	Pubtator	37749624	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	37749624	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	CTD_human_DG	30664745		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	22957024		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22957024	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17667919		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17667919	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	18384079, 18452185, 22467522, 26324098, 26575296, 28233670		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	23717480	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASDB_DG	21738487, 22438815, 24842889		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28586827	Associate	★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	21383526		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37543650	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	21508513, 24075295, 24077033, 24099078, 24950747, 26872620, 27550842, 28663121, 28686326, 28793974, 29505471, 30124114, 30807663, 31291236, 31655035		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	18565889		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	17010515, 19022385		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29315139		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22350180		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	22360979	Associate	★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	23529111		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24166410, 24933348		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	PSYGENET_DG	24166410		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19409562	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35482673	Inhibit	★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	22194899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinoblastoma	Retinoblastoma	BEFREE	11247813, 9166723		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11352772, 21360527		★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	BEFREE	27534449		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	26575296		★☆☆☆☆ Found in Text Mining only
Secondary Adrenal Insufficiency	Adrenal Insufficiency	BEFREE	30282821		★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	35896530	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28951706		★☆☆☆☆ Found in Text Mining only
Spasms Infantile	Infantile spasms	Pubtator	27534449	Stimulate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38241377	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22948128, 23539366, 29115460		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16122764, 16815632, 19844206, 22467522, 23962971, 27544317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22249355, 22467522, 23157339, 23529111, 23962971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urticaria	Urticaria	LHGDN	16297195		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19409562	Associate	★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	27663146		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	35905107	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	27663146		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	23123321, 25954915, 27534449		★☆☆☆☆ Found in Text Mining only