Gene Gene information from NCBI Gene database.
Entrez ID 139285
Gene name APC membrane recruitment protein 1
Gene symbol AMER1
Synonyms (NCBI Gene)
FAM123BOSCSWTX
Chromosome X
Chromosome location Xq11.2
Summary The protein encoded by this gene upregulates trancriptional activation by the Wilms tumor protein and interacts with many other proteins, including CTNNB1, APC, AXIN1, and AXIN2. Defects in this gene are a cause of osteopathia striata with cranial scleros
SNPs SNP information provided by dbSNP.
18
SNP ID Visualize variation Clinical significance Consequence
rs137852216 G>A Pathogenic Coding sequence variant, stop gained
rs137852217 G>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs387906722 A>T Pathogenic Stop gained, coding sequence variant
rs387907269 G>A Pathogenic Stop gained, coding sequence variant
rs398122877 G>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
501
miRTarBase ID miRNA Experiments Reference
MIRT020401 hsa-miR-29c-3p Sequencing 20371350
MIRT051169 hsa-miR-16-5p CLASH 23622248
MIRT042310 hsa-miR-484 CLASH 23622248
MIRT508108 hsa-miR-34b-3p HITS-CLIP 21572407
MIRT508106 hsa-miR-410-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0001822 Process Kidney development IEA
GO:0005515 Function Protein binding IPI 17510365, 17925383, 21304492, 22682247, 24251807, 26496610, 33961781
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IBA
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IDA 21304492
GO:0005546 Function Phosphatidylinositol-4,5-bisphosphate binding IMP 17925383
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300647 26837 ENSG00000184675
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5JTC6
Protein name APC membrane recruitment protein 1 (Amer1) (Protein FAM123B) (Wilms tumor gene on the X chromosome protein)
Protein function Regulator of the canonical Wnt signaling pathway. Acts by specifically binding phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2), translocating to the cell membrane and interacting with key regulators of the canonical Wnt signaling pathway,
PDB 4YJE , 4YJL , 4YK6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09422 WTX 89 457 WTX protein Family
PF09422 WTX 452 536 WTX protein Family
Tissue specificity TISSUE SPECIFICITY: Detected in fetal and adult kidney, brain and spleen. {ECO:0000269|PubMed:19416806}.
Sequence
METQKDEAAQAKGAAASGSTREQTAEKGAKNKAAEATEGPTSEPSSSGPGRLKKTAMKLF
GGKKGICTLPSFFGGGRSKGSGKGSSKKGLSKSKTHDGLSEAAHGPEDVVSEGTGFSLPL
PELPCQFPSSQSAHGALETGSRCKTSVAGATEKAVAEKFPSMPKPKKGLKGFFSSIRRHR
KSKVTGAEQSEPGAKGPERVRARPHEHVSSAPQVPCFEETFQAPRKENANPQDAPGPKVS
PTPEPSPPATEKMACKDPEKPMEACASAHVQPKPAPEASSLEEPHSPETGEKVVAGEVNP
PNGPVGDPLSLLFGDVTSLKSFDSLTGCGDIIAEQDMDSMTDSMASGGQRANRDGTKRSS
CLVTYQGGGEEMALPDDDDEEEEEEEEVELEEEEEEVKEEEEDDDLEYLWETAQMYPRPN
MNLGYHPTTSPGHHGYMLLDPVRSYPGLAPG
ELLTPQSDQQESAPNSDEGYYDSTTPGFE
DDSGEALGLVRRDCLPRDSYSGDALYEFYEPDDSLENSPPGDDCLYDLHGRSSEMF
DPFL
NFEPFLSSRPPGAMETEEERLVTIQKQLLYWELRREQLEAQEARAREAHAREAHAREAYT
REAYGREAYAREAHTWEAHGREARTREAQAREVRCRETQVRETQARQEKPVLEYQMRPLG
PSVMGLAAGVSGTSQISHRGITSAFPTTASSEPDWRDFRPLEKRYEGTCSKKDQSTCLMQ
LFQSDAMFEPDMQEANFGGSPRRAYPTYSPPEDPEEEEVEKEGNATVSFSQALVEFTSNG
NLFSSMSCSSDSDSSFTQNLPELPPMVTFDIADVERDGEGKCEENPEFHNDEDLAASLEA
FELGYYHKHAFNNYHSRFYQGLPWGVSSLPRYLGLPGLHPRPPPAAMALNRRSRSLDTAE
TLEMELSNSHLVQGYLESDELQAQQEDSDEEDEEEEEGEWSRDSPLSLYTEPPGAYDWPA
WAPCPLPVGPGPAWISPNQLDRPSSQSPYRQATCCIPPMTMSISLSVPESRAPGESGPQL
ARPSHLHLPMGPCYNLQPQASQSMRARPRDVLLPVDEPSCSSSSGGFSPSPLPQAKPVGI
THGIPQLPRVRPEHPQPQPTHYGPSSLDLSKERAEQGASLATSYSSTAMNGNLAK
Sequence length 1135
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Degradation of beta-catenin by the destruction complex
Beta-catenin phosphorylation cascade
Disassembly of the destruction complex and recruitment of AXIN to the membrane
Misspliced GSK3beta mutants stabilize beta-catenin
S33 mutants of beta-catenin aren't phosphorylated
S37 mutants of beta-catenin aren't phosphorylated
S45 mutants of beta-catenin aren't phosphorylated
T41 mutants of beta-catenin aren't phosphorylated
APC truncation mutants have impaired AXIN binding
AXIN missense mutants destabilize the destruction complex
Truncations of AMER1 destabilize the destruction complex
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
18
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
AMER1-related disorder Pathogenic rs137852217 RCV003398482
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cleft palate Likely pathogenic; Pathogenic rs1602067592 RCV001526571
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colorectal cancer Pathogenic; Likely pathogenic rs1930207901, rs1930230724, rs1930277434 RCV001293807
RCV001293808
RCV001293809
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm Pathogenic rs137852216 RCV004668713
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
FEBRILE CONVULSIONS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Febrile seizure (within the age range of 3 months to 6 years) Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Intellectual disability Benign; Likely benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenomatous Polyposis Coli Multiple polyposis syndrome BEFREE 17510365, 20978149, 24251807
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum BEFREE 20978149
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 28326956
★☆☆☆☆
Found in Text Mining only
Aortic coarctation Aortic Coarctation HPO_DG
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic Valve Sclerosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Aphasia Aphasia HPO_DG
★☆☆☆☆
Found in Text Mining only
Aplasia Cutis Congenita Aplasia Cutis Congenita BEFREE 20978149
★☆☆☆☆
Found in Text Mining only
Arachnodactyly Arachnodactyly HPO_DG
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect HPO_DG
★☆☆☆☆
Found in Text Mining only
Beckwith-Wiedemann Syndrome Beckwith-Wiedemann Syndrome BEFREE 20978149
★☆☆☆☆
Found in Text Mining only