CRH (corticotropin releasing hormone)

Gene

• Entrez ID: 1392
• Gene name: Corticotropin releasing hormone
• Gene symbol: CRH
• Synonyms (NCBI Gene): CRF, CRH1
• Chromosome: 8
• Chromosome location: 8q13.1
• Summary: This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PV

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs12721510	G>T	Pathogenic	Upstream transcript variant
rs72556399	C>G	Pathogenic	Upstream transcript variant
rs748404250	G>A,C,T	Uncertain-significance, pathogenic, likely-benign	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021551	hsa-miR-142-3p	Microarray	17612493
MIRT1969592	hsa-miR-3978	CLIP-seq
MIRT1969593	hsa-miR-4307	CLIP-seq
MIRT1969594	hsa-miR-556-3p	CLIP-seq
MIRT1969595	hsa-miR-875-3p	CLIP-seq
MIRT2205735	hsa-miR-3183	CLIP-seq
MIRT2205736	hsa-miR-4287	CLIP-seq
MIRT2205737	hsa-miR-4469	CLIP-seq
MIRT2205738	hsa-miR-4685-3p	CLIP-seq
MIRT2205739	hsa-miR-4723-3p	CLIP-seq
MIRT2205740	hsa-miR-642a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AR	Repression	16446741
ESR1	Repression	12161509
ESR2	Repression	12161509
NR4A2	Unknown	11315917
RARA	Activation	19596122

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001963	Process	Synaptic transmission, dopaminergic	IDA	12895416
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0005102	Function	Signaling receptor binding	TAS	7477348
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	7585095
GO:0005184	Function	Neuropeptide hormone activity	TAS	7867564
GO:0005515	Function	Protein binding	IPI	18234674, 18801728, 20966082, 25416956, 28514442, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18559919
GO:0005615	Component	Extracellular space	IEA
GO:0006704	Process	Glucocorticoid biosynthetic process	IEA
GO:0006954	Process	Inflammatory response	IDA	18559919
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	7867564
GO:0007268	Process	Chemical synaptic transmission	TAS	7477348
GO:0007565	Process	Female pregnancy	IDA	18559919
GO:0007565	Process	Female pregnancy	TAS	7585095
GO:0007567	Process	Parturition	TAS	7585095
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	TAS	7477348
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008306	Process	Associative learning	IEA
GO:0008628	Process	Hormone-mediated apoptotic signaling pathway	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010700	Process	Negative regulation of norepinephrine secretion	IEA
GO:0010841	Process	Positive regulation of circadian sleep/wake cycle, wakefulness	NAS	18329818
GO:0014062	Process	Regulation of serotonin secretion	IEA
GO:0016101	Process	Diterpenoid metabolic process	IEA
GO:0017045	Function	Corticotropin-releasing hormone activity	IBA
GO:0021854	Process	Hypothalamus development	IEA
GO:0030324	Process	Lung development	IEA
GO:0030325	Process	Adrenal gland development	IEA
GO:0032811	Process	Negative regulation of epinephrine secretion	IBA
GO:0032811	Process	Negative regulation of epinephrine secretion	IEA
GO:0033685	Process	Negative regulation of luteinizing hormone secretion	IEA
GO:0035641	Process	Locomotory exploration behavior	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035902	Process	Response to immobilization stress	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042322	Process	Negative regulation of circadian sleep/wake cycle, REM sleep	NAS	18329818
GO:0043025	Component	Neuronal cell body	IEA
GO:0043196	Component	Varicosity	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043627	Process	Response to estrogen	IEA
GO:0045202	Component	Synapse	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045472	Process	Response to ether	IEA
GO:0048265	Process	Response to pain	IEA
GO:0050801	Process	Monoatomic ion homeostasis	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051430	Function	Corticotropin-releasing hormone receptor 1 binding	IEA
GO:0051431	Function	Corticotropin-releasing hormone receptor 2 binding	IEA
GO:0051461	Process	Positive regulation of corticotropin secretion	IDA	11329063
GO:0051461	Process	Positive regulation of corticotropin secretion	IEA
GO:0051464	Process	Positive regulation of cortisol secretion	IBA
GO:0051464	Process	Positive regulation of cortisol secretion	IDA	18329818
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060456	Process	Positive regulation of digestive system process	IEA
GO:0070093	Process	Negative regulation of glucagon secretion	IBA
GO:0070093	Process	Negative regulation of glucagon secretion	IEA
GO:0071314	Process	Cellular response to cocaine	IEA
GO:0071549	Process	Cellular response to dexamethasone stimulus	IEA
GO:0090280	Process	Positive regulation of calcium ion import	IEA
GO:0097305	Process	Response to alcohol	IEA
GO:0099013	Component	Neuronal dense core vesicle lumen	IEA
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IEA
GO:1904044	Process	Response to aldosterone	IEA
GO:2000310	Process	Regulation of NMDA receptor activity	IDA	12895416
GO:2000854	Process	Positive regulation of corticosterone secretion	IEA
GO:2000987	Process	Positive regulation of behavioral fear response	IEA

Other IDs

• MIM: 122560
• HGNC: 2355
• e!Ensembl: ENSG00000147571

Protein

• UniProt ID: P06850
• Protein name: Corticoliberin (Corticotropin-releasing factor) (CRF) (Corticotropin-releasing hormone)
• Protein function: Hormone regulating the release of corticotropin from pituitary gland (By similarity). Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile (By similarity). {ECO:0000250|UniProtKB:P06296, ECO:0000250|UniProtKB:
• PDB: 1GO9, 1GOE, 3EHT, 3EHU, 6P9X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00473	CRF	157 → 194	Corticotropin-releasing factor family	Family

• Tissue specificity: TISSUE SPECIFICITY: Produced by the hypothalamus and placenta. {ECO:0000269|PubMed:2783917, ECO:0000269|PubMed:3262120}.
• Sequence:

  MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQ
  ARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLL
  LPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQL
  AQQAHSNRKLMEIIGK

• Sequence length: 196

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Long-term depression
Cushing syndrome
Alcoholism

Reactome:

Class B/2 (Secretin family receptors)
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant nocturnal frontal lobe epilepsy	Likely benign; not provided	ClinVar Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRH-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTOGENIC WEST SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUSHING SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTHYMIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, FRONTAL LOBE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOMOTOR DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALAAM SEIZURES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WEST SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ABCD syndrome	Abcd syndrome	Pubtator	33244004	Associate	★☆☆☆☆ Found in Text Mining only
Acne	Acne	BEFREE	19077080		★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	19077080		★☆☆☆☆ Found in Text Mining only
ACTH Deficiency, Isolated	ACTH Deficiency	BEFREE	8882784		★☆☆☆☆ Found in Text Mining only
ACTH Syndrome, Ectopic	Ectopic ACTH secretion syndrome	BEFREE	11932296		★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	27220856, 28986303, 9100600		★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	31100090		★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	15126546, 20923424, 28780517, 28819949, 29390437, 31133546		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	16721033, 2118538, 27220856, 28986303, 30502716, 31062234, 8636444		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	30502716		★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	15126546, 20923424, 31597820		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	14557423, 15914529, 16721033, 7921204		★☆☆☆☆ Found in Text Mining only
Adrenocorticotropic hormone (ACTH) deficiency (disorder)	Adrenocorticotropic Hormone Deficiency	BEFREE	28819949, 8882784		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28780517		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	29391399		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	11586016		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	21359208		★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	11586016		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	21359208		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30837843		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	21359208		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	10915835		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	BEFREE	29033027, 31792153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	BEFREE	10223285, 15567470, 17183713, 28299639, 29574216, 30739813		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	CTD_human_DG	16420149		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia Nervosa	Anorexia	BEFREE	1547737, 1597149, 29574216, 9118350		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	11827739, 11848730, 14755129, 15126546, 15192151, 15310462, 15771006, 16733617, 20010888, 20368512, 20383137, 20548294, 21616602, 22336193, 24123648, 25051447, 27595593, 28103781, 28103782, 28119322, 28499100, 28500827, 28689880, 28863347, 29037972, 29118713, 29246866, 29477300, 29618970, 29786085, 30054732, 30170157, 30217435, 30245730, 30266597, 30499109, 30530860, 30566247, 30760067, 30881446, 30979915, 31494142, 9062354, 9118350, 9535288		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	18801728, 24123648	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	11440811, 11875628, 12424556, 12438692, 14575894, 16495007, 17293045, 21268831, 22231481, 7816204, 8736133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	11827739, 11848730, 14755129, 15126546, 15192151, 15310462, 15771006, 16733617, 16884458, 20010888, 20368512, 20383137, 20548294, 21616602, 22336193, 24123648, 25051447, 26923505, 27595593, 28103781, 28103782, 28119322, 28500827, 28689880, 28863347, 29037972, 29118713, 29246866, 29477300, 29618970, 29786085, 30054732, 30170157, 30217435, 30245730, 30266597, 30499109, 30530860, 30566247, 30760067, 30881446, 30979915, 31494142, 9062354, 9118350, 9535288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	16884458, 26923505	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	11440811, 11875628, 12424556, 12438692, 14575894, 16495007, 17293045, 21268831, 22231481, 7816204, 8736133		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28780517		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	11315917, 11508426, 12114266, 31489921, 8335947		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	11315917, 11508426	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	11315917	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	7489943	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10943856, 11817611, 15077295	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11315917	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	11315917, 11508426		★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	LHGDN	15077295		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18408560		★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	28844644		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28390681, 31515731		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31220952, 31344805		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Nocturnal Epilepsy	ORPHANET_DG	16222669		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Autosomal dominant nocturnal frontal lobe epilepsy	Nocturnal Epilepsy	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Nocturnal Epilepsy	BEFREE	17324557, 17900292, 23593457		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Autosomal Dominant Nocturnal Frontal Lobe Epilepsy	Nocturnal frontal lobe epilepsy	Pubtator	17900292, 23593457	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Bedwetting	Nocturnal enuresis	BEFREE	27887910, 31256952		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10893493, 9399692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	10893493, 24211652, 9399692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26331704	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17804209, 20630588, 22494987, 23821771, 24046091, 31127466		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19490624, 23076876	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	28576418, 28833350		★☆☆☆☆ Found in Text Mining only
Carcinoid tumor of lung	Carcinoid Tumor Of Lung	BEFREE	9838245		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37382757	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30922523, 30991880, 31626760		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	9118350		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24841552		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24841552		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8770924, 9408232		★☆☆☆☆ Found in Text Mining only
Chronic interstitial cystitis	Interstitial Cystitis	BEFREE	31844086		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25514610		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26420894		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19096201		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	9118350		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	CTD_human_DG	16039799		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	29713130		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	7489943	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31614860		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29291617	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	7756609		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	11848730, 28500827		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia due to 21 hydroxylase deficiency	Congenital adrenal hyperplasia	BEFREE	11848730		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27754786, 30003813		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27695045, 31721113		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17011352		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17011352		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	39742022	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17011352, 29867541		★☆☆☆☆ Found in Text Mining only
Cryptogenic Infantile Spasms	Cryptogenic West syndrome	CTD_human_DG	11341487		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	12053094, 1597149, 20923424, 27241967, 28433999, 28444400, 28614036, 29144801, 30502716, 31041631, 7805653		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing Syndrome	Cushing`s Syndrome	CTD_human_DG	21359208		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing Syndrome	Cushing syndrome	Pubtator	36074996, 37062723	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis Interstitial	Interstitial cystitis	Pubtator	31844086	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	24318839, 8335947		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29115460		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	12438692, 18698320		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	31388769		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	11027914, 11848730, 12147330, 14960621, 15126546, 15365580, 1597149, 16122764, 16124836, 16733617, 16884458, 18250257, 18423590, 18427561, 19596121, 19596122, 19846118, 20010888, 20368512, 20548294, 20693543, 20957648, 21616602, 23110080, 23583320, 23726670, 27582123, 28119322, 28377228, 28429110, 28461011, 28500827, 28655495, 28735061, 29080675, 29118713, 29150144, 29767278, 29907890, 30022063, 30499109, 30831439, 31017816, 31312123, 31570003, 31619956, 9118350, 9399692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	12438692, 18698320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	16884458, 18250257, 18801728, 36184597	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	23726670, 23768074, 24630468, 25422958, 25578258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	26371764	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	12438692, 18698320		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22360979	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Seborrheic	Seborrheic dermatitis	Pubtator	12011471	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22000570, 24033157, 29023418		★☆☆☆☆ Found in Text Mining only
Developmental Psychomotor Disorders	Psychomotor Disorders	CTD_human_DG	1335535		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30280757		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	37633918	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	2022703, 30280757		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	33244004	Associate	★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	BEFREE	28028605, 28265716		★☆☆☆☆ Found in Text Mining only
Dysthymic Disorder	Dysthymic Disorder	BEFREE	10889527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysthymic Disorder	Dysthymic Disorder	PSYGENET_DG	10889527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonia Disorders	Dystonia	BEFREE	23449625		★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	11337088, 29056155		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22000570, 24033157, 29023418		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27487831	Inhibit	★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	12438692, 18698320		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	BEFREE	29150144		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23076876		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19433256, 23638035	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	27567427		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	21289256, 23638035, 25473847, 29137551, 29916119		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	23638035	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Nocturnal Frontal Lobe Type 1	Nocturnal frontal lobe epilepsy	Pubtator	23593457	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Frontal Lobe	Epilepsy	LHGDN	16222669		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Etat Marbre	Status marmoratus	CTD_human_DG	21618986		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Familial Glucocorticoid Deficiency 1	Glucocorticoid deficiency	Pubtator	19544245, 8227361	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	30929860	Associate	★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	23773973		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	19357112		★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	7682155		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	12519893		★☆☆☆☆ Found in Text Mining only
Generalized Epilepsy With Febrile Seizures Plus Type 1	Generalized epilepsy with febrile seizures plus	Pubtator	23773973	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	12051390		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25239507		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25239507		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29981322		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	7756609		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	19544245	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27754786, 30003813		★☆☆☆☆ Found in Text Mining only
Hematuria, Benign Familial	Hematuria	BEFREE	19357112		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	22257050		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22257050	Stimulate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	Pubtator	26331704	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30689675		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	17280790	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28932747, 30354709, 30565964, 31326852, 31560870		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	11788380, 22703673		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30508752		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	31737064		★☆☆☆☆ Found in Text Mining only
Ileus	Ileus	LHGDN	17693031		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22475622, 30651328, 31199033, 31212019		★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	25954915, 27534449		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29115460, 31564717		★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	31844086		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22957021, 26808377, 26882083, 27038676, 27497153, 28963545, 29179184, 29483895, 29979696, 30139928, 30616026, 30663229, 30704133, 30935894, 31272268, 31570003, 31737064		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	22957021, 26808377, 33244004	Associate	★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	31714276		★☆☆☆☆ Found in Text Mining only
Jackknife Seizures	Jackknife Seizures	CTD_human_DG	11341487		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	8835601	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21575632, 25514610, 25779204, 26138585, 27113502, 28170426, 28240194, 28689880, 28807676, 28823817, 29776484, 30217435, 30478032, 31017816, 31141179, 31330967, 31451580		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27695045	Associate	★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	12074902, 20548294, 27550842, 28439099, 28450265, 28614607, 28833350, 29037972, 29118713, 29414029, 30078057, 30691514, 30782210, 31178693, 31649527, 9695128		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24518041		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19096201		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	24518041		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15934435		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15934435		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15934435		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15934435		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	9399692		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	14573312, 15196881, 1547737, 15504420, 16815632, 17258395, 17599466, 19846118, 20237460, 22378896, 26055202, 26271720, 28251369, 28589964, 28755509, 29317606		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	19846118, 20029939, 20692103, 22378896, 23529111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	26138585		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	23225430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17804209, 20630588, 22494987, 23821771, 31127466		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27695045		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24776847		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12843181, 20630588, 25960164, 27695045, 28418869, 28917270		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24841552		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31614860		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	17804209		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20630588		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	12053094		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	12843181		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	12438692, 18698320		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	29150144		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10536983	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11936276		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23416839		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	11027914, 11848730, 12147330, 14960621, 15126546, 15365580, 1597149, 16122764, 16124836, 16733617, 16884458, 18250257, 18423590, 18427561, 19596121, 19596122, 19846118, 20010888, 20548294, 20693543, 20957648, 21616602, 23583320, 23726670, 27582123, 28377228, 28429110, 28461011, 28500827, 28655495, 28735061, 29080675, 29118713, 29150144, 29767278, 29907890, 30022063, 30499109, 30831439, 31312123, 31570003, 31619956, 9118350, 9399692		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	23726670, 23768074, 24630468, 25422958, 25578258		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	11137059, 11848730, 21616602, 27997737, 28511913		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30400826		★☆☆☆☆ Found in Text Mining only
Microangiopathy, Diabetic	Diabetic cardiomyopathy	BEFREE	30280757		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	11337098, 26138585, 27809751, 28750312, 28823817, 30124114, 30427333		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11337098, 14755129, 15310462, 15899517, 16446741, 16611089, 17599466, 17728670, 19596122, 28119322, 28429110, 28689880, 30217435, 30478032, 30499109, 31212019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	17599466, 17728670, 17908177, 18475271, 19596122		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	CTD_human_DG	21618986		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12843181, 15567470, 16721033, 17667919, 20630588, 2118538, 24046091, 24412750, 27695045, 28179447, 28433999, 28986303, 29080355, 29981322, 30502716, 31041631, 31714276, 7805653, 9838245		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10446900, 16446741, 25960164		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29907890, 30427333, 31641098		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	28614036, 30502716, 8636444		★☆☆☆☆ Found in Text Mining only
Neuroretinitis	Neuroretinitis	CTD_human_DG	11384150		★☆☆☆☆ Found in Text Mining only
Nodding spasm	Spasmus nutans	CTD_human_DG	11341487		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	7756609		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11555839, 28103784, 28299639		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	35276788	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	15126546		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23821771		★☆☆☆☆ Found in Text Mining only
Olivopontocerebellar Atrophies	Olivopontocerebellar Atrophies	BEFREE	28844644		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17667919		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17667919		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17667919, 23076876	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	31100090		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	14675801		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	BEFREE	15953484, 29391399		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	34132705	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	7756609		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	14557423, 15914529, 16721033, 7921204		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	BEFREE	17102093		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	15953484		★☆☆☆☆ Found in Text Mining only
Pituitary Apoplexy	Pituitary Apoplexy	CTD_human_DG	12699433, 12699434		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	1597149, 28444400, 30214395		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27908212, 37543650	Associate	★☆☆☆☆ Found in Text Mining only
POPLITEAL PTERYGIUM SYNDROME, LETHAL TYPE	Bartsocas-Papas syndrome	BEFREE	31844086		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	24075295, 24950747, 27898588, 28663121, 28793974, 29268182, 29505471, 30124114, 30807663, 30898126, 31212019, 31675389		★☆☆☆☆ Found in Text Mining only
Precocious Puberty	Precocious puberty	BEFREE	25051447		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	7477348		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24776847		★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	CTD_human_DG	21359208		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	22283733, 22350180, 23303587		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	22283733, 22360979	Associate	★☆☆☆☆ Found in Text Mining only
Psychomotor Disorders	Psychomotor Disorders	CTD_human_DG	1335535		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent major depressive episodes	Mental Depression	BEFREE	23529111		★☆☆☆☆ Found in Text Mining only
Regular astigmatism - corneal	Corneal astigmatism	BEFREE	30868919		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27695045		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31721113		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	11867951		★☆☆☆☆ Found in Text Mining only
Retinitis	Retinitis	CTD_human_DG	11384150		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11247813, 12413940, 9166723		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10943856, 11315917, 11352772, 11508426, 11817611, 12077707, 12114266, 12734882, 12867582, 22703673, 8335947, 9002043		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15077295		★☆☆☆☆ Found in Text Mining only
Salaam Seizures	Salaam Seizures	CTD_human_DG	11341487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salaam Seizures	Salaam Seizures	BEFREE	27534449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	12865891		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	21810631, 29767278		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia Spectrum and Other Psychotic Disorders	Schizophrenia	Pubtator	37401376	Associate	★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	31299439		★☆☆☆☆ Found in Text Mining only
Secondary Adrenal Insufficiency	Adrenal Insufficiency	BEFREE	30086867		★☆☆☆☆ Found in Text Mining only
Seizures Febrile	Seizures	Pubtator	23773973	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22073145, 28690980		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	12011471	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28500766		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	11337098		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	7925116		★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	BEFREE	29330004		★☆☆☆☆ Found in Text Mining only
Spasms Infantile	Infantile spasms	Pubtator	27534449	Stimulate	★☆☆☆☆ Found in Text Mining only
spasmus nutans	Spasmus nutans	CTD_human_DG	11341487		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Degeneration	Spinocerebellar Degeneration	BEFREE	28844644		★☆☆☆☆ Found in Text Mining only
Spinocerebellar tract degeneration	Spinocerebellar Degeneration	BEFREE	28844644		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15567470, 9506767		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	7756609		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	7756609		★☆☆☆☆ Found in Text Mining only
Symptomatic Infantile Spasms	Symptomatic West syndrome	CTD_human_DG	11341487		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38241377	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12519893, 7489943		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	12438692, 18698320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	14573312, 15196881, 1547737, 15504420, 16815632, 19846118, 22475622, 26055202, 26271720, 28755509, 29317606		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	19846118, 20692103, 22378896, 22475622, 23529111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23076876	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11520404		★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	31595394	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	11074187, 1596084, 1700951, 1914160, 7821275, 8923670		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	27663146		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	35905107	Associate	★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	27663146		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	CTD_human_DG	11341487		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
West Syndrome	West Syndrome	BEFREE	25954915, 27534449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations