Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1388
Gene name	Activating transcription factor 6 beta
Gene symbol	ATF6B
Synonyms (NCBI Gene)	ATF6betaCREB-RPCREBL1G13
Chromosome	6
Chromosome location	6p21.32
Summary	The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004191	hsa-miR-197-3p	Microarray	16822819
MIRT645450	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT645449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT645448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT645447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT645446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT645445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT645444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT645442	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT645443	hsa-miR-3662	HITS-CLIP	23824327
MIRT645441	hsa-miR-3646	HITS-CLIP	23824327
MIRT645440	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645439	hsa-miR-4780	HITS-CLIP	23824327
MIRT645438	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT645437	hsa-miR-4433a-5p	HITS-CLIP	23824327
MIRT645436	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645435	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645434	hsa-miR-623	HITS-CLIP	23824327
MIRT645433	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT645432	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT645431	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT645430	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT645428	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT645429	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT645450	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT645449	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT645448	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT645447	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT645446	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT645445	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT645444	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT645442	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT645443	hsa-miR-3662	HITS-CLIP	23824327
MIRT645441	hsa-miR-3646	HITS-CLIP	23824327
MIRT645440	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT645439	hsa-miR-4780	HITS-CLIP	23824327
MIRT645438	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT645437	hsa-miR-4433a-5p	HITS-CLIP	23824327
MIRT645436	hsa-miR-1260a	HITS-CLIP	23824327
MIRT645435	hsa-miR-1260b	HITS-CLIP	23824327
MIRT645434	hsa-miR-623	HITS-CLIP	23824327
MIRT645433	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT645432	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT645431	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT645430	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT645428	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT645429	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT804398	hsa-miR-103a	CLIP-seq
MIRT804399	hsa-miR-107	CLIP-seq
MIRT804400	hsa-miR-1257	CLIP-seq
MIRT804401	hsa-miR-1260	CLIP-seq
MIRT804402	hsa-miR-1280	CLIP-seq
MIRT804403	hsa-miR-132	CLIP-seq
MIRT804404	hsa-miR-141	CLIP-seq
MIRT804405	hsa-miR-197	CLIP-seq
MIRT804406	hsa-miR-200a	CLIP-seq
MIRT804407	hsa-miR-212	CLIP-seq
MIRT804408	hsa-miR-224	CLIP-seq
MIRT804409	hsa-miR-3123	CLIP-seq
MIRT804410	hsa-miR-3925-5p	CLIP-seq
MIRT804411	hsa-miR-4263	CLIP-seq
MIRT804412	hsa-miR-4270	CLIP-seq
MIRT804413	hsa-miR-4302	CLIP-seq
MIRT804414	hsa-miR-4441	CLIP-seq
MIRT804415	hsa-miR-4660	CLIP-seq
MIRT804416	hsa-miR-4697-3p	CLIP-seq
MIRT804417	hsa-miR-4704-5p	CLIP-seq
MIRT804418	hsa-miR-4790-3p	CLIP-seq
MIRT804419	hsa-miR-494	CLIP-seq
MIRT804420	hsa-miR-646	CLIP-seq
MIRT804401	hsa-miR-1260	CLIP-seq
MIRT804402	hsa-miR-1280	CLIP-seq
MIRT804404	hsa-miR-141	CLIP-seq
MIRT804406	hsa-miR-200a	CLIP-seq
MIRT1937532	hsa-miR-4667-5p	CLIP-seq
MIRT1937533	hsa-miR-4700-5p	CLIP-seq
MIRT804417	hsa-miR-4704-5p	CLIP-seq
MIRT804419	hsa-miR-494	CLIP-seq
MIRT804401	hsa-miR-1260	CLIP-seq
MIRT804402	hsa-miR-1280	CLIP-seq
MIRT804400	hsa-miR-1257	CLIP-seq
MIRT2384546	hsa-miR-2467-3p	CLIP-seq
MIRT804413	hsa-miR-4302	CLIP-seq
MIRT804416	hsa-miR-4697-3p	CLIP-seq
MIRT804418	hsa-miR-4790-3p	CLIP-seq
MIRT2480470	hsa-miR-1233	CLIP-seq
MIRT2480471	hsa-miR-1253	CLIP-seq
MIRT2480472	hsa-miR-1255a	CLIP-seq
MIRT2480473	hsa-miR-1255b	CLIP-seq
MIRT2480474	hsa-miR-27a	CLIP-seq
MIRT2480475	hsa-miR-27b	CLIP-seq
MIRT2480476	hsa-miR-3169	CLIP-seq
MIRT2480477	hsa-miR-371-5p	CLIP-seq
MIRT2480478	hsa-miR-377	CLIP-seq
MIRT2480479	hsa-miR-4515	CLIP-seq
MIRT2480480	hsa-miR-4712-3p	CLIP-seq
MIRT2480481	hsa-miR-4766-5p	CLIP-seq
MIRT2480482	hsa-miR-4778-5p	CLIP-seq
MIRT2480483	hsa-miR-4786-3p	CLIP-seq
MIRT2480484	hsa-miR-513a-5p	CLIP-seq
MIRT2480485	hsa-miR-637	CLIP-seq
MIRT2480470	hsa-miR-1233	CLIP-seq
MIRT2480471	hsa-miR-1253	CLIP-seq
MIRT2480472	hsa-miR-1255a	CLIP-seq
MIRT2480473	hsa-miR-1255b	CLIP-seq
MIRT2480474	hsa-miR-27a	CLIP-seq
MIRT2480475	hsa-miR-27b	CLIP-seq
MIRT2480476	hsa-miR-3169	CLIP-seq
MIRT2480477	hsa-miR-371-5p	CLIP-seq
MIRT2480478	hsa-miR-377	CLIP-seq
MIRT2480479	hsa-miR-4515	CLIP-seq
MIRT2480480	hsa-miR-4712-3p	CLIP-seq
MIRT2480481	hsa-miR-4766-5p	CLIP-seq
MIRT2480482	hsa-miR-4778-5p	CLIP-seq
MIRT2480483	hsa-miR-4786-3p	CLIP-seq
MIRT2480484	hsa-miR-513a-5p	CLIP-seq
MIRT2480485	hsa-miR-637	CLIP-seq

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	11256944
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11256944
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	14973138
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11256944
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8586413
GO:0005515	Function	Protein binding	IPI	12445808, 23661758
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11256944
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	23661758
GO:0005634	Component	Nucleus	TAS	8586413, 22013210
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	11256944
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	NAS	11256944
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	22013210
GO:0005794	Component	Golgi apparatus	TAS	22013210
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	23661758
GO:0006986	Process	Response to unfolded protein	IEA
GO:0007165	Process	Signal transduction	TAS	8586413
GO:0016020	Component	Membrane	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA
GO:0032993	Component	Protein-DNA complex	IDA	11256944
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	11256944
GO:0034976	Process	Response to endoplasmic reticulum stress	TAS	22013210
GO:0036500	Process	ATF6-mediated unfolded protein response	IEA
GO:0036500	Process	ATF6-mediated unfolded protein response	NAS	32046286
GO:0036500	Process	ATF6-mediated unfolded protein response	TAS	22013210
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11256944, 14973138
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	22013210
GO:0090575	Component	RNA polymerase II transcription regulator complex	IDA	11256944
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	23661758
GO:1903891	Process	Regulation of ATF6-mediated unfolded protein response	IEA
GO:1903892	Process	Negative regulation of ATF6-mediated unfolded protein response	IDA	9837962
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
600984	2349	ENSG00000213676

Q99941

Protein name

Cyclic AMP-dependent transcription factor ATF-6 beta (cAMP-dependent transcription factor ATF-6 beta) (Activating transcription factor 6 beta) (ATF6-beta) (Protein G13) (cAMP response element-binding protein-related protein) (Creb-rp) (cAMP-responsive ele

Protein function

[Cyclic AMP-dependent transcription factor ATF-6 beta]: Precursor of the transcription factor form (Processed cyclic AMP-dependent transcription factor ATF-6 beta), which is embedded in the endoplasmic reticulum membrane (PubMed:11256944). Endop

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00170	bZIP_1	323 → 389	bZIP transcription factor	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11256944}.

Sequence

MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP

Sequence length

703

Interactions

View interactions

	KEGG
	cGMP-PKG signaling pathway Protein processing in endoplasmic reticulum PI3K-Akt signaling pathway Longevity regulating pathway Adrenergic signaling in cardiomyocytes TNF signaling pathway Dopaminergic synapse Insulin secretion Estrogen signaling pathway Thyroid hormone synthesis Aldosterone synthesis and secretion Relaxin signaling pathway Cortisol synthesis and secretion Parathyroid hormone synthesis, secretion and action Cushing syndrome Growth hormone synthesis, secretion and action Prion disease Cocaine addiction Amphetamine addiction Alcoholism Hepatitis B Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Viral carcinogenesis Chemical carcinogenesis - receptor activation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29928342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29530003, 35617355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	19851445, 21695597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19851445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29459183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoidosis	Sarcoidosis	GWASCAT_DG	26651848		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Takayasu Arteritis	Takayasu Arteritis	GWASCAT_DG	25604533		★★★★★ ★☆☆☆☆ Found in Text Mining only

ATF6B (activating transcription factor 6 beta)