Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	138429
Gene name	Phosphatidylinositol-4-phosphate 5-kinase like 1
Gene symbol	PIP5KL1
Synonyms (NCBI Gene)	PIPKH
Chromosome	9
Chromosome location	9q34.11
Summary	PIP5KL1 is a phosphoinositide kinase-like protein that lacks intrinsic lipid kinase activity but associates with type I PIPKs (see PIP5K1A; MIM 603275) and may play a role in localization of PIPK activity (Chang et al., 2004 [PubMed 14701839]).[supplied b

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016777	hsa-miR-335-5p	Microarray	18185580
MIRT1236057	hsa-miR-1271	CLIP-seq
MIRT1236058	hsa-miR-1285	CLIP-seq
MIRT1236059	hsa-miR-1288	CLIP-seq
MIRT1236060	hsa-miR-2277-5p	CLIP-seq
MIRT1236061	hsa-miR-3177-3p	CLIP-seq
MIRT1236062	hsa-miR-3187-5p	CLIP-seq
MIRT1236063	hsa-miR-3199	CLIP-seq
MIRT1236064	hsa-miR-4479	CLIP-seq
MIRT1236065	hsa-miR-4731-5p	CLIP-seq
MIRT1236066	hsa-miR-564	CLIP-seq
MIRT1236067	hsa-miR-612	CLIP-seq
MIRT1236068	hsa-miR-96	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IDA	16751333
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016308	Function	1-phosphatidylinositol-4-phosphate 5-kinase activity	IBA
GO:0016308	Function	1-phosphatidylinositol-4-phosphate 5-kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	19680787
GO:0042995	Component	Cell projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16751333
GO:0046488	Process	Phosphatidylinositol metabolic process	IEA
GO:0046854	Process	Phosphatidylinositol phosphate biosynthetic process	IBA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	19680787
GO:0052742	Function	Phosphatidylinositol kinase activity	IEA

MIM	HGNC	e!Ensembl
612865	28711	ENSG00000167103

Q5T9C9

Protein name

Phosphatidylinositol 4-phosphate 5-kinase-like protein 1 (PI(4)P 5-kinase-like protein 1) (PtdIns(4)P-5-kinase-like protein 1) (EC 2.7.1.68)

Protein function

May act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3. {ECO:0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01504	PIP5K	128 → 392	Phosphatidylinositol-4-phosphate 5-Kinase	Family

Sequence

MAAPSPGPREVLAPSPEAGCRAVTSSRRGLLWRLRDKQSRLGLFEISPGHELHGMTCMMQ
AGLWAATQVSMDHPPTGPPSRDDFSEVLTQVHEGFELGTLAGPAFAWLRRSLGLAEEDYQ
AALGPGGPYLQFLSTSKSKASFFLSHDQRFFLKTQGRREVQALLAHLPRYVQHLQRHPHS
LLARLLGVHSLRVDRGKKTYFIVMQSVFYPAGRISERYDIKGCEVSRWVDPAPEGSPLVL
VLKDLNFQGKTINLGPQRSWFLRQMELDTTFLRELNVLDYSLLIAFQRLHEDERGPGSSL
IFRTARSVQGAQSPEESRAQNRRLLPDAPNALHILDGPEQRYFLGVVDLATVYGLRKRLE
HLWKTLRYPGRTFSTVSPARYARRLCQWVEAHTE

Sequence length

394

Interactions

View interactions

	KEGG
	Inositol phosphate metabolism Metabolic pathways Endocytosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma in situ of stomach	Stomach Carcinoma	BEFREE	19680787	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19947914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19947914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19680787	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19680787, 19947914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19947914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19947914	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19680787	★★★★★ ★☆☆☆☆ Found in Text Mining only

PIP5KL1 (phosphatidylinositol-4-phosphate 5-kinase like 1)