Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1382
Gene name	Cellular retinoic acid binding protein 2
Gene symbol	CRABP2
Synonyms (NCBI Gene)	CRABP-IIRBP6
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a member of the retinoic acid (RA, a form of vitamin A) binding protein family and lipocalin/cytosolic fatty-acid binding protein family. The protein is a cytosol-to-nuclear shuttling protein, which facilitates RA binding to its cognate

256

Show/Hide all (256)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019800	hsa-miR-375	Microarray	20215506
MIRT907929	hsa-miR-1262	CLIP-seq
MIRT907930	hsa-miR-1285	CLIP-seq
MIRT907931	hsa-miR-1288	CLIP-seq
MIRT907932	hsa-miR-1301	CLIP-seq
MIRT907933	hsa-miR-1303	CLIP-seq
MIRT907934	hsa-miR-1587	CLIP-seq
MIRT907935	hsa-miR-184	CLIP-seq
MIRT907936	hsa-miR-1908	CLIP-seq
MIRT907937	hsa-miR-2110	CLIP-seq
MIRT907938	hsa-miR-3117-3p	CLIP-seq
MIRT907939	hsa-miR-3127-3p	CLIP-seq
MIRT907940	hsa-miR-3132	CLIP-seq
MIRT907941	hsa-miR-3150a-3p	CLIP-seq
MIRT907942	hsa-miR-3154	CLIP-seq
MIRT907943	hsa-miR-3169	CLIP-seq
MIRT907944	hsa-miR-3173-3p	CLIP-seq
MIRT907945	hsa-miR-3175	CLIP-seq
MIRT907946	hsa-miR-3187-5p	CLIP-seq
MIRT907947	hsa-miR-3194-3p	CLIP-seq
MIRT907948	hsa-miR-326	CLIP-seq
MIRT907949	hsa-miR-330-5p	CLIP-seq
MIRT907950	hsa-miR-34a	CLIP-seq
MIRT907951	hsa-miR-3648	CLIP-seq
MIRT907952	hsa-miR-378g	CLIP-seq
MIRT907953	hsa-miR-3936	CLIP-seq
MIRT907954	hsa-miR-4260	CLIP-seq
MIRT907955	hsa-miR-4283	CLIP-seq
MIRT907956	hsa-miR-4417	CLIP-seq
MIRT907957	hsa-miR-4435	CLIP-seq
MIRT907958	hsa-miR-4437	CLIP-seq
MIRT907959	hsa-miR-4486	CLIP-seq
MIRT907960	hsa-miR-4489	CLIP-seq
MIRT907961	hsa-miR-4492	CLIP-seq
MIRT907962	hsa-miR-4498	CLIP-seq
MIRT907963	hsa-miR-449b	CLIP-seq
MIRT907964	hsa-miR-4506	CLIP-seq
MIRT907965	hsa-miR-4648	CLIP-seq
MIRT907966	hsa-miR-4650-3p	CLIP-seq
MIRT907967	hsa-miR-4651	CLIP-seq
MIRT907968	hsa-miR-4656	CLIP-seq
MIRT907969	hsa-miR-4665-3p	CLIP-seq
MIRT907970	hsa-miR-4674	CLIP-seq
MIRT907971	hsa-miR-4675	CLIP-seq
MIRT907972	hsa-miR-4701-3p	CLIP-seq
MIRT907973	hsa-miR-4701-5p	CLIP-seq
MIRT907974	hsa-miR-4706	CLIP-seq
MIRT907975	hsa-miR-4725-5p	CLIP-seq
MIRT907976	hsa-miR-4741	CLIP-seq
MIRT907977	hsa-miR-4749-5p	CLIP-seq
MIRT907978	hsa-miR-4759	CLIP-seq
MIRT907979	hsa-miR-4779	CLIP-seq
MIRT907980	hsa-miR-504	CLIP-seq
MIRT907981	hsa-miR-5047	CLIP-seq
MIRT907982	hsa-miR-541	CLIP-seq
MIRT907983	hsa-miR-548v	CLIP-seq
MIRT907984	hsa-miR-555	CLIP-seq
MIRT907985	hsa-miR-588	CLIP-seq
MIRT907986	hsa-miR-608	CLIP-seq
MIRT907987	hsa-miR-612	CLIP-seq
MIRT907988	hsa-miR-628-5p	CLIP-seq
MIRT907989	hsa-miR-654-5p	CLIP-seq
MIRT907990	hsa-miR-663	CLIP-seq
MIRT907991	hsa-miR-663b	CLIP-seq
MIRT907992	hsa-miR-762	CLIP-seq
MIRT907993	hsa-miR-939	CLIP-seq
MIRT907994	hsa-miR-134	CLIP-seq
MIRT907995	hsa-miR-3118	CLIP-seq
MIRT907942	hsa-miR-3154	CLIP-seq
MIRT907944	hsa-miR-3173-3p	CLIP-seq
MIRT907996	hsa-miR-324-5p	CLIP-seq
MIRT907997	hsa-miR-361-3p	CLIP-seq
MIRT907953	hsa-miR-3936	CLIP-seq
MIRT907967	hsa-miR-4651	CLIP-seq
MIRT907979	hsa-miR-4779	CLIP-seq
MIRT907984	hsa-miR-555	CLIP-seq
MIRT907986	hsa-miR-608	CLIP-seq
MIRT907993	hsa-miR-939	CLIP-seq
MIRT1969127	hsa-miR-1253	CLIP-seq
MIRT907929	hsa-miR-1262	CLIP-seq
MIRT907930	hsa-miR-1285	CLIP-seq
MIRT907932	hsa-miR-1301	CLIP-seq
MIRT907933	hsa-miR-1303	CLIP-seq
MIRT907935	hsa-miR-184	CLIP-seq
MIRT1969128	hsa-miR-185	CLIP-seq
MIRT907936	hsa-miR-1908	CLIP-seq
MIRT1969129	hsa-miR-1972	CLIP-seq
MIRT907937	hsa-miR-2110	CLIP-seq
MIRT1969130	hsa-miR-3074-5p	CLIP-seq
MIRT1969131	hsa-miR-3124-3p	CLIP-seq
MIRT907939	hsa-miR-3127-3p	CLIP-seq
MIRT907941	hsa-miR-3150a-3p	CLIP-seq
MIRT1969132	hsa-miR-3150b-3p	CLIP-seq
MIRT907945	hsa-miR-3175	CLIP-seq
MIRT907946	hsa-miR-3187-5p	CLIP-seq
MIRT907950	hsa-miR-34a	CLIP-seq
MIRT907951	hsa-miR-3648	CLIP-seq
MIRT1969133	hsa-miR-370	CLIP-seq
MIRT907952	hsa-miR-378g	CLIP-seq
MIRT1969134	hsa-miR-4306	CLIP-seq
MIRT907956	hsa-miR-4417	CLIP-seq
MIRT907957	hsa-miR-4435	CLIP-seq
MIRT907958	hsa-miR-4437	CLIP-seq
MIRT907959	hsa-miR-4486	CLIP-seq
MIRT907963	hsa-miR-449b	CLIP-seq
MIRT907964	hsa-miR-4506	CLIP-seq
MIRT1969135	hsa-miR-4644	CLIP-seq
MIRT1969136	hsa-miR-4650-5p	CLIP-seq
MIRT907970	hsa-miR-4674	CLIP-seq
MIRT907972	hsa-miR-4701-3p	CLIP-seq
MIRT907973	hsa-miR-4701-5p	CLIP-seq
MIRT907974	hsa-miR-4706	CLIP-seq
MIRT907977	hsa-miR-4749-5p	CLIP-seq
MIRT1969137	hsa-miR-4784	CLIP-seq
MIRT907981	hsa-miR-5047	CLIP-seq
MIRT907982	hsa-miR-541	CLIP-seq
MIRT907985	hsa-miR-588	CLIP-seq
MIRT907987	hsa-miR-612	CLIP-seq
MIRT907989	hsa-miR-654-5p	CLIP-seq
MIRT907990	hsa-miR-663	CLIP-seq
MIRT907991	hsa-miR-663b	CLIP-seq
MIRT1969138	hsa-miR-765	CLIP-seq
MIRT1969139	hsa-miR-767-3p	CLIP-seq
MIRT907993	hsa-miR-939	CLIP-seq
MIRT907933	hsa-miR-1303	CLIP-seq
MIRT907935	hsa-miR-184	CLIP-seq
MIRT907950	hsa-miR-34a	CLIP-seq
MIRT907952	hsa-miR-378g	CLIP-seq
MIRT907957	hsa-miR-4435	CLIP-seq
MIRT907963	hsa-miR-449b	CLIP-seq
MIRT2205111	hsa-miR-451b	CLIP-seq
MIRT1969129	hsa-miR-1972	CLIP-seq
MIRT1969130	hsa-miR-3074-5p	CLIP-seq
MIRT1969131	hsa-miR-3124-3p	CLIP-seq
MIRT1969133	hsa-miR-370	CLIP-seq
MIRT1969136	hsa-miR-4650-5p	CLIP-seq
MIRT1969139	hsa-miR-767-3p	CLIP-seq
MIRT1969129	hsa-miR-1972	CLIP-seq
MIRT1969130	hsa-miR-3074-5p	CLIP-seq
MIRT1969131	hsa-miR-3124-3p	CLIP-seq
MIRT1969133	hsa-miR-370	CLIP-seq
MIRT1969136	hsa-miR-4650-5p	CLIP-seq
MIRT1969139	hsa-miR-767-3p	CLIP-seq
MIRT1969127	hsa-miR-1253	CLIP-seq
MIRT907929	hsa-miR-1262	CLIP-seq
MIRT907930	hsa-miR-1285	CLIP-seq
MIRT907931	hsa-miR-1288	CLIP-seq
MIRT907932	hsa-miR-1301	CLIP-seq
MIRT907933	hsa-miR-1303	CLIP-seq
MIRT907934	hsa-miR-1587	CLIP-seq
MIRT1969128	hsa-miR-185	CLIP-seq
MIRT907936	hsa-miR-1908	CLIP-seq
MIRT1969129	hsa-miR-1972	CLIP-seq
MIRT907937	hsa-miR-2110	CLIP-seq
MIRT1969130	hsa-miR-3074-5p	CLIP-seq
MIRT907938	hsa-miR-3117-3p	CLIP-seq
MIRT1969131	hsa-miR-3124-3p	CLIP-seq
MIRT907939	hsa-miR-3127-3p	CLIP-seq
MIRT907941	hsa-miR-3150a-3p	CLIP-seq
MIRT1969132	hsa-miR-3150b-3p	CLIP-seq
MIRT907943	hsa-miR-3169	CLIP-seq
MIRT907945	hsa-miR-3175	CLIP-seq
MIRT907946	hsa-miR-3187-5p	CLIP-seq
MIRT907947	hsa-miR-3194-3p	CLIP-seq
MIRT907948	hsa-miR-326	CLIP-seq
MIRT907949	hsa-miR-330-5p	CLIP-seq
MIRT1969133	hsa-miR-370	CLIP-seq
MIRT907952	hsa-miR-378g	CLIP-seq
MIRT907954	hsa-miR-4260	CLIP-seq
MIRT907955	hsa-miR-4283	CLIP-seq
MIRT1969134	hsa-miR-4306	CLIP-seq
MIRT907958	hsa-miR-4437	CLIP-seq
MIRT907959	hsa-miR-4486	CLIP-seq
MIRT907960	hsa-miR-4489	CLIP-seq
MIRT907961	hsa-miR-4492	CLIP-seq
MIRT907962	hsa-miR-4498	CLIP-seq
MIRT907964	hsa-miR-4506	CLIP-seq
MIRT2205111	hsa-miR-451b	CLIP-seq
MIRT1969135	hsa-miR-4644	CLIP-seq
MIRT1969136	hsa-miR-4650-5p	CLIP-seq
MIRT907968	hsa-miR-4656	CLIP-seq
MIRT907970	hsa-miR-4674	CLIP-seq
MIRT907971	hsa-miR-4675	CLIP-seq
MIRT2508454	hsa-miR-4696	CLIP-seq
MIRT907972	hsa-miR-4701-3p	CLIP-seq
MIRT907974	hsa-miR-4706	CLIP-seq
MIRT907975	hsa-miR-4725-5p	CLIP-seq
MIRT907976	hsa-miR-4741	CLIP-seq
MIRT907977	hsa-miR-4749-5p	CLIP-seq
MIRT907978	hsa-miR-4759	CLIP-seq
MIRT1969137	hsa-miR-4784	CLIP-seq
MIRT907980	hsa-miR-504	CLIP-seq
MIRT907981	hsa-miR-5047	CLIP-seq
MIRT907987	hsa-miR-612	CLIP-seq
MIRT907988	hsa-miR-628-5p	CLIP-seq
MIRT907990	hsa-miR-663	CLIP-seq
MIRT907992	hsa-miR-762	CLIP-seq
MIRT1969138	hsa-miR-765	CLIP-seq
MIRT1969139	hsa-miR-767-3p	CLIP-seq
MIRT907993	hsa-miR-939	CLIP-seq
MIRT1969127	hsa-miR-1253	CLIP-seq
MIRT907929	hsa-miR-1262	CLIP-seq
MIRT907930	hsa-miR-1285	CLIP-seq
MIRT907931	hsa-miR-1288	CLIP-seq
MIRT907932	hsa-miR-1301	CLIP-seq
MIRT907933	hsa-miR-1303	CLIP-seq
MIRT907934	hsa-miR-1587	CLIP-seq
MIRT1969128	hsa-miR-185	CLIP-seq
MIRT907936	hsa-miR-1908	CLIP-seq
MIRT1969129	hsa-miR-1972	CLIP-seq
MIRT907937	hsa-miR-2110	CLIP-seq
MIRT1969130	hsa-miR-3074-5p	CLIP-seq
MIRT907938	hsa-miR-3117-3p	CLIP-seq
MIRT1969131	hsa-miR-3124-3p	CLIP-seq
MIRT907939	hsa-miR-3127-3p	CLIP-seq
MIRT907941	hsa-miR-3150a-3p	CLIP-seq
MIRT1969132	hsa-miR-3150b-3p	CLIP-seq
MIRT907943	hsa-miR-3169	CLIP-seq
MIRT907945	hsa-miR-3175	CLIP-seq
MIRT907946	hsa-miR-3187-5p	CLIP-seq
MIRT907947	hsa-miR-3194-3p	CLIP-seq
MIRT907948	hsa-miR-326	CLIP-seq
MIRT907949	hsa-miR-330-5p	CLIP-seq
MIRT1969133	hsa-miR-370	CLIP-seq
MIRT907952	hsa-miR-378g	CLIP-seq
MIRT907954	hsa-miR-4260	CLIP-seq
MIRT907955	hsa-miR-4283	CLIP-seq
MIRT1969134	hsa-miR-4306	CLIP-seq
MIRT907957	hsa-miR-4435	CLIP-seq
MIRT907958	hsa-miR-4437	CLIP-seq
MIRT907959	hsa-miR-4486	CLIP-seq
MIRT907960	hsa-miR-4489	CLIP-seq
MIRT907961	hsa-miR-4492	CLIP-seq
MIRT907962	hsa-miR-4498	CLIP-seq
MIRT907964	hsa-miR-4506	CLIP-seq
MIRT1969135	hsa-miR-4644	CLIP-seq
MIRT1969136	hsa-miR-4650-5p	CLIP-seq
MIRT907968	hsa-miR-4656	CLIP-seq
MIRT907970	hsa-miR-4674	CLIP-seq
MIRT907971	hsa-miR-4675	CLIP-seq
MIRT907972	hsa-miR-4701-3p	CLIP-seq
MIRT907974	hsa-miR-4706	CLIP-seq
MIRT907975	hsa-miR-4725-5p	CLIP-seq
MIRT907976	hsa-miR-4741	CLIP-seq
MIRT907977	hsa-miR-4749-5p	CLIP-seq
MIRT907978	hsa-miR-4759	CLIP-seq
MIRT1969137	hsa-miR-4784	CLIP-seq
MIRT907980	hsa-miR-504	CLIP-seq
MIRT907981	hsa-miR-5047	CLIP-seq
MIRT907987	hsa-miR-612	CLIP-seq
MIRT907988	hsa-miR-628-5p	CLIP-seq
MIRT907990	hsa-miR-663	CLIP-seq
MIRT907992	hsa-miR-762	CLIP-seq
MIRT1969138	hsa-miR-765	CLIP-seq
MIRT1969139	hsa-miR-767-3p	CLIP-seq
MIRT907993	hsa-miR-939	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
TFAP2A	Activation	17187826
TFAP2C	Activation	17187826

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001972	Function	Retinoic acid binding	IBA
GO:0001972	Function	Retinoic acid binding	IEA
GO:0005501	Function	Retinoid binding	TAS	1334086
GO:0005504	Function	Fatty acid binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15866176
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15866176
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	TAS	1334086
GO:0007165	Process	Signal transduction	TAS	1654334
GO:0008289	Function	Lipid binding	IEA
GO:0008544	Process	Epidermis development	TAS	1654334
GO:0015908	Process	Fatty acid transport	IBA
GO:0016918	Function	Retinal binding	IEA
GO:0019841	Function	Retinol binding	IEA
GO:0030332	Function	Cyclin binding	IDA	12482873
GO:0035115	Process	Embryonic forelimb morphogenesis	IEA
GO:0042573	Process	Retinoic acid metabolic process	IEA
GO:0048672	Process	Positive regulation of collateral sprouting	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
180231	2339	ENSG00000143320

P29373

Protein name

Cellular retinoic acid-binding protein 2 (Cellular retinoic acid-binding protein II) (CRABP-II)

Protein function

Transports retinoic acid to the nucleus. Regulates the access of retinoic acid to the nuclear retinoic acid receptors.

PDB

1BLR , 1BM5 , 1CBQ , 1CBS , 1XCA , 2CBS , 2FR3 , 2FRS , 2FS6 , 2FS7 , 2G78 , 2G79 , 2G7B , 3CBS , 3CR6 , 3CWK , 3D95 , 3D96 , 3D97 , 3F8A , 3F9D , 3FA6 , 3FA7 , 3FA8 , 3FA9 , 3FEK , 3FEL , 3FEN , 3FEP , 3I17 , 4I9R , 4I9S , 4M6S , 4M7M , 4QGV , 4QGW , 4QGX , 4YBP , 4YBU , 4YCE , 4YCH , 4YDA , 4YDB , 4YFP , 4YFQ , 4YFR , 4YGG , 4YGH , 4YGZ , 4YH0 , 4YKM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	5 → 138	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Sequence

MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVR
TTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGEL
ILTMTADDVVCTRVYVRE

Sequence length

138

Interactions

View interactions

	Reactome
			Signaling by Retinoic Acid

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AORTIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHYLMALONIC ACIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHYLMALONIC ACIDURIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (90)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	24751108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24751108, 28983631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28502478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22153617, 31736873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31736873		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	22010213, 28881741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29880835, 37597518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	22275178, 25797252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	37597518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11909957, 12907615, 15870697, 17187826, 26142905, 29731607, 31419991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26142905, 29731607, 37715025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24709110	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12907615, 25320093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29930489, 30696915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	38195606	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24709110, 35260193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	8618041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28502478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22153617, 31736873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16215318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	BEFREE	28752682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	8844119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	8844119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	8844119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	18621984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23337719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31962291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25797252, 26893190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20019841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	29731607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	LHGDN	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia, Familial Combined	Hyperlipidemia	BEFREE	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	29880835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35628257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	12907615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29731607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	17484622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	12844477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	LHGDN	12844477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25034531, 29930489	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30696915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25034531	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15870697, 17187826, 26142905, 29731607, 31419991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29930489, 30696915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16211222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30696915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	28502478, 29131833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17187826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26142905, 31419991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22153617, 31736873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22153617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37539569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	9293476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	20019841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12907615, 16912187, 18955045, 19197536, 22010213, 22275178, 25320093, 25797252, 26839961, 28502478, 29378601, 9568080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	18955045, 29378601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	16237707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16912187, 18955045, 7786028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	28502478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	28502478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29930489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	8179592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22321069	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38195606	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22010213, 28881741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35260193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nerve Sheath Neoplasm	Peripheral Nerve Sheath Neoplasm	BEFREE	28502478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16211222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18500686, 32881426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	16215318, 26416422, 8931868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16215318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35671035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16215318, 26416422, 29880835, 8931868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	26945879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	26945879		★★★★★ ★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	24713395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	16237707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24751108, 26945879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26839961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	17079134, 20019841	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17079134, 20019841, 9568080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36195596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	33786631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28350049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	24709110	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	29378601, 30155617, 32214060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CRABP2 (cellular retinoic acid binding protein 2)