Gene Gene information from NCBI Gene database.
Entrez ID 138050
Gene name Heparan-alpha-glucosaminide N-acetyltransferase
Gene symbol HGSNAT
Synonyms (NCBI Gene)
HGNATMPS3CRP73TMEM76
Chromosome 8
Chromosome location 8p11.21-p11.1
Summary This gene encodes a lysosomal acetyltransferase, which is one of several enzymes involved in the lysosomal degradation of heparin sulfate. Mutations in this gene are associated with Sanfilippo syndrome C, one type of the lysosomal storage disease mucopoly
SNPs SNP information provided by dbSNP.
46
SNP ID Visualize variation Clinical significance Consequence
rs112029032 G>A Likely-pathogenic, benign-likely-benign, conflicting-interpretations-of-pathogenicity, likely-benign, pathogenic Coding sequence variant, genic downstream transcript variant, missense variant
rs121908282 C>T Likely-pathogenic, pathogenic Intron variant, coding sequence variant, missense variant
rs121908283 T>G Pathogenic Intron variant, stop gained, coding sequence variant
rs121908284 T>A Pathogenic Missense variant, coding sequence variant
rs121908285 C>T Pathogenic, likely-pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
346
miRTarBase ID miRNA Experiments Reference
MIRT039742 hsa-miR-615-3p CLASH 23622248
MIRT1044910 hsa-miR-1207-3p CLIP-seq
MIRT1044911 hsa-miR-122 CLIP-seq
MIRT1044912 hsa-miR-1226 CLIP-seq
MIRT1044913 hsa-miR-1228 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0005764 Component Lysosome IEA
GO:0005765 Component Lysosomal membrane HDA 17897319
GO:0005765 Component Lysosomal membrane IBA
GO:0005765 Component Lysosomal membrane IDA 19823584, 20650889
GO:0005765 Component Lysosomal membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610453 26527 ENSG00000165102
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q68CP4
Protein name Heparan-alpha-glucosaminide N-acetyltransferase (EC 2.3.1.78) (Transmembrane protein 76)
Protein function Lysosomal acetyltransferase that acetylates the non-reducing terminal alpha-glucosamine residue of intralysosomal heparin or heparan sulfate, converting it into a substrate for luminal alpha-N-acetyl glucosaminidase. {ECO:0000269|PubMed:16960811
PDB 8JKV , 8JL1 , 8JL3 , 8JL4 , 8TU9 , 8VKJ , 8VLG , 8VLI , 8VLU , 8VLV , 8VLY , 8W4A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07786 DUF1624 267 428 Protein of unknown function (DUF1624) Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed, with highest level in leukocytes, heart, liver, skeletal muscle, lung, placenta and liver. {ECO:0000269|PubMed:16960811, ECO:0000269|PubMed:17033958}.
Sequence
MTGARASAAEQRRAGRSGQARAAERAAGMSGAGRALAALLLAASVLSAALLAPGGSSGRD
AQAAPPRDLDKKRHAELKMDQALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPK
AGKPSAAAASVSTQHGSILQLNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACD
LAVNEDPVDSNLPVSIAFLIGLAVIIVISFLRLLLSLDDFNNWISKAISSRETDRLINSE
LGSPSRTDPLDGDVQPATWRLSALPPRLRSVDTFRGIALILMVFVNYGGGKYWYFKHASW
NGLTVADLVFPWFVFIMGSSIFLSMTSILQRGCSKFRLLGKIAWRSFLLICIGIIIVNPN
YCLGPLSWDKVRIPGVLQRLGVTYFVVAVLELLFAKPVPEHCASERSCLSLRDITSSWPQ
WLLILVLE
GLWLGLTFLLPVPGCPTGYLGPGGIGDFGKYPNCTGGAAGYIDRLLLGDDHL
YQHPSSAVLYHTEVAYDPEGILGTINSIVMAFLGVQAGKILLYYKARTKDILIRFTAWCC
ILGLISVALTKVSENEGFIPVNKNLWSLSYVTTLSSFAFFILLVLYPVVDVKGLWTGTPF
FYPGMNSILVYVGHEVFENYFPFQWKLKDNQSHKEHLTQNIVATALWVLIAYILYRKKIF
WKI
Sequence length 663
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Glycosaminoglycan degradation
Metabolic pathways
Lysosome
  HS-GAG degradation
MPS IIIC - Sanfilippo syndrome C
Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
32
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Acute myeloid leukemia Likely pathogenic; Pathogenic rs398124544 RCV005887677
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
HGSNAT-related disorder Likely pathogenic rs2486908416 RCV003412142
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mucopolysaccharidosis Pathogenic rs370717845 RCV001030804
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mucopolysaccharidosis, MPS-III-C Likely pathogenic; Pathogenic rs398124544, rs398124545, rs2130722124, rs1220771600, rs1803180587, rs2130745878, rs2130766198, rs2130783742, rs771455190, rs2130819661, rs2130648385, rs2130648345, rs767574122, rs2130746148, rs375616017
View all (108 more)
RCV000668206
RCV000671662
RCV001379518
RCV001390498
RCV001386044
View all (124 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cervical cancer Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired Kyphoscoliosis Acquired Kyphoscoliosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Asymmetric Septal Hypertrophy Septal Hypertrophy HPO_DG
★☆☆☆☆
Found in Text Mining only
Brain atrophy Brain atrophy CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Cataract Cataract HPO_DG
★☆☆☆☆
Found in Text Mining only
Clumsiness - motor delay Motor delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Conductive hearing loss Hearing Loss HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital hypoplasia of penis Congenital Hypoplasia Of Penis HPO_DG
★☆☆☆☆
Found in Text Mining only
Congenital kyphoscoliosis Congenital kyphoscoliosis HPO_DG
★☆☆☆☆
Found in Text Mining only
Deglutition Disorders Dysphagia HPO_DG
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus HPO_DG
★☆☆☆☆
Found in Text Mining only