Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	138009
Gene name	DDB1 and CUL4 associated factor 4 like 2
Gene symbol	DCAF4L2
Synonyms (NCBI Gene)	WDR21C
Chromosome	8
Chromosome location	8q21.3

Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017989	hsa-miR-335-5p	Microarray	18185580
MIRT569839	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT569839	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT925057	hsa-miR-1233	CLIP-seq
MIRT925058	hsa-miR-1245b-3p	CLIP-seq
MIRT925059	hsa-miR-129-3p	CLIP-seq
MIRT925060	hsa-miR-1297	CLIP-seq
MIRT925061	hsa-miR-1322	CLIP-seq
MIRT925062	hsa-miR-181a	CLIP-seq
MIRT925063	hsa-miR-181b	CLIP-seq
MIRT925064	hsa-miR-181c	CLIP-seq
MIRT925065	hsa-miR-181d	CLIP-seq
MIRT925066	hsa-miR-26a	CLIP-seq
MIRT925067	hsa-miR-26b	CLIP-seq
MIRT925068	hsa-miR-3613-3p	CLIP-seq
MIRT925069	hsa-miR-3614-3p	CLIP-seq
MIRT925070	hsa-miR-3646	CLIP-seq
MIRT925071	hsa-miR-425	CLIP-seq
MIRT925072	hsa-miR-4262	CLIP-seq
MIRT925073	hsa-miR-4465	CLIP-seq
MIRT925074	hsa-miR-4698	CLIP-seq
MIRT925075	hsa-miR-4735-5p	CLIP-seq
MIRT925076	hsa-miR-4780	CLIP-seq
MIRT925077	hsa-miR-494	CLIP-seq
MIRT925078	hsa-miR-548ac	CLIP-seq
MIRT925079	hsa-miR-548ae	CLIP-seq
MIRT925080	hsa-miR-548aj	CLIP-seq
MIRT925081	hsa-miR-548am	CLIP-seq
MIRT925082	hsa-miR-548c-3p	CLIP-seq
MIRT925083	hsa-miR-548d-3p	CLIP-seq
MIRT925084	hsa-miR-548x	CLIP-seq
MIRT925085	hsa-miR-548z	CLIP-seq
MIRT925086	hsa-miR-607	CLIP-seq
MIRT1974023	hsa-miR-331-3p	CLIP-seq
MIRT1974024	hsa-miR-339-5p	CLIP-seq
MIRT925068	hsa-miR-3613-3p	CLIP-seq
MIRT1974025	hsa-miR-3679-3p	CLIP-seq
MIRT1974026	hsa-miR-377	CLIP-seq
MIRT2209607	hsa-miR-129-5p	CLIP-seq
MIRT2209608	hsa-miR-1910	CLIP-seq
MIRT2209609	hsa-miR-455-3p	CLIP-seq
MIRT2209610	hsa-miR-4776-3p	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IBA

MIM	HGNC	e!Ensembl
620421	26657	ENSG00000176566

Q8NA75

Protein name

DDB1- and CUL4-associated factor 4-like protein 2 (WD repeat-containing protein 21C)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00400	WD40	262 → 298	WD domain, G-beta repeat	Repeat

Sequence

MESKRPRLLEEADKQKKTVRVGLNAPSMLRKNQLGFLRFANYCRIARELRVSCMQRKKVQ
IHSWDPSSLASDRFNRILANTNTDQLFTVNQVEAGGSKYGIITMRGLTTPELRVYPHKTL
YVPNRKVNSMCWASLNHLDSHLLLCFVGLADTPSCAVLLPASLFIGSFPGMRRPGMLCSF
QIPDAWSCAWSLSIHAYHSFSTGLSQQVLLTNVVTGHQQSFGTSSDVLAQQFAIMTPLLF
NGCRSGEIFGIDLRCGNQGSGWKAICLSHDSAVTSLQILQDGQFLVSSDMTGTIKLWDLR
ATKCVTQYEGHVNNSAYLPVHVNEEEGVVAAVGQDCYTRIWSLRHGHLLTTIPSPYPASE
NDIPSVAFSSRLGGFRGAPGLLMAVREDLYCFSYG

Sequence length

395

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DCAF4L2-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32685988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	23512105, 35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32685988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otofaciocervical Syndrome	Otofaciocervical syndrome	Pubtator	35191549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DCAF4L2 (DDB1 and CUL4 associated factor 4 like 2)