GOT1L1 (glutamic-oxaloacetic transaminase 1 like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 137362
Gene name Glutamic-oxaloacetic transaminase 1 like 1
Gene symbol GOT1L1
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8p11.23
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018437 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0004069 Function L-aspartate:2-oxoglutarate aminotransferase activity IBA
GO:0004069 Function L-aspartate:2-oxoglutarate aminotransferase activity IEA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IBA
GO:0006520 Process Amino acid metabolic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NHS2
Protein name Putative aspartate aminotransferase, cytoplasmic 2 (EC 2.6.1.1) (Glutamate oxaloacetate transaminase 1-like protein 1) (Transaminase A-like protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00155 Aminotran_1_2 30 → 395 Aminotransferase class I and II Domain
Sequence 
MPTLSVFMDVPLAHKLEGSLLKTYKQDDYPNKIFLAYRVCMTNEGHPWVSLVVQKTRLQI
SQDPSLNYEYLPTMGLKSFIQASLALLFGKHSQAIVENRVGGVHTVGDSGAFQLGVQFLR
AWHKDARIVYIISSQKELHGLVFQDMGFTVYEYSVWDPKKLCMDPDILLNVVEQIPHGCV
LVMGNIIDCKLTPSGWAKLMSMIKSKQIFPFFDIPCQGLYTSDLEEDTRILQYFVSQGFE
FFCSQSLSKNFGIYDEGVGMLVVVAVNNQQLLCVLSQLEGLAQALWLNPPNTGARVITSI
LCNPALLGEWKQSLKEVVENIMLTKEKVKEKLQLLGTPGSWGHITEQSGTHGYLGLNSQQ
VEYLVRKKHIYIPKNGQINFSCINANNINYITEGINEAVLLTESSEMCLPKEKKTLIGIK
L
Sequence length 421
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Cysteine and methionine metabolism
Arginine and proline metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Sort by:
GOT1 10 shared pathwaysArginine biosynthesis, Alanine, aspartate and glutamate metabolism, Cysteine and methionine metabolism, Arginine and proline metabolism, Tyrosine metabolism, Phenylalanine metabolism, Phenylalanine, tyrosine and tryptophan biosynthesis, Carbon metabolism, 2-Oxocarboxylic acid metabolism, Biosynthesis of amino acids Related via 10 shared pathways including Arginine biosynthesis, Alanine, aspartate and glutamate metabolism. GOT2 10 shared pathwaysArginine biosynthesis, Alanine, aspartate and glutamate metabolism, Cysteine and methionine metabolism, Arginine and proline metabolism, Tyrosine metabolism, Phenylalanine metabolism, Phenylalanine, tyrosine and tryptophan biosynthesis, Carbon metabolism, 2-Oxocarboxylic acid metabolism, Biosynthesis of amino acids Related via 10 shared pathways including Arginine biosynthesis, Alanine, aspartate and glutamate metabolism. GPT 5 shared pathwaysArginine biosynthesis, Alanine, aspartate and glutamate metabolism, Carbon metabolism, 2-Oxocarboxylic acid metabolism, Biosynthesis of amino acids Related via 5 shared pathways including Arginine biosynthesis, Alanine, aspartate and glutamate metabolism. GPT2 5 shared pathwaysArginine biosynthesis, Alanine, aspartate and glutamate metabolism, Carbon metabolism, 2-Oxocarboxylic acid metabolism, Biosynthesis of amino acids Related via 5 shared pathways including Arginine biosynthesis, Alanine, aspartate and glutamate metabolism. IL4I1 5 shared pathwaysAlanine, aspartate and glutamate metabolism, Cysteine and methionine metabolism, Tyrosine metabolism, Phenylalanine metabolism, Phenylalanine, tyrosine and tryptophan biosynthesis Related via 5 shared pathways including Alanine, aspartate and glutamate metabolism, Cysteine and methionine metabolism.
Hearing loss Linked via 2 of 5 related genesGOT1, IL4I1 Amyloidosis Linked via 1 of 5 related genesGOT1 Amyotrophic lateral sclerosis Linked via 1 of 5 related genesGOT1 Peripheral arterial disease Linked via 1 of 5 related genesGOT1 Scoliosis Linked via 1 of 5 related genesGOT1