CPN2 (carboxypeptidase N subunit 2)

Gene

• Entrez ID: 1370
• Gene name: Carboxypeptidase N subunit 2
• Gene symbol: CPN2
• Synonyms (NCBI Gene): ACBP
• Chromosome: 3
• Chromosome location: 3q29

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029261	hsa-miR-26b-5p	Microarray	19088304
MIRT906477	hsa-miR-1252	CLIP-seq
MIRT906478	hsa-miR-1284	CLIP-seq
MIRT906479	hsa-miR-2355-5p	CLIP-seq
MIRT906480	hsa-miR-3127-3p	CLIP-seq
MIRT906481	hsa-miR-3150b-3p	CLIP-seq
MIRT906482	hsa-miR-4267	CLIP-seq
MIRT906483	hsa-miR-4313	CLIP-seq
MIRT906484	hsa-miR-4662a-3p	CLIP-seq
MIRT906485	hsa-miR-4684-5p	CLIP-seq
MIRT906486	hsa-miR-4768-5p	CLIP-seq
MIRT906487	hsa-miR-4784	CLIP-seq
MIRT906488	hsa-miR-501-5p	CLIP-seq
MIRT906489	hsa-miR-577	CLIP-seq
MIRT906490	hsa-miR-765	CLIP-seq
MIRT1968669	hsa-miR-2115	CLIP-seq
MIRT1968670	hsa-miR-3153	CLIP-seq
MIRT1968671	hsa-miR-4645-5p	CLIP-seq
MIRT1968672	hsa-miR-4673	CLIP-seq
MIRT1968673	hsa-miR-516a-3p	CLIP-seq
MIRT2204785	hsa-miR-3688-3p	CLIP-seq
MIRT2204786	hsa-miR-4261	CLIP-seq
MIRT2204787	hsa-miR-4694-3p	CLIP-seq
MIRT2204788	hsa-miR-522	CLIP-seq
MIRT2204789	hsa-miR-563	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	2378615
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0030234	Function	Enzyme regulator activity	NAS	2378615
GO:0038023	Function	Signaling receptor activity	IBA
GO:0050821	Process	Protein stabilization	NAS	2378615
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 603104
• HGNC: 2313
• e!Ensembl: ENSG00000178772

Protein

• UniProt ID: P22792
• Protein name: Carboxypeptidase N subunit 2 (Carboxypeptidase N 83 kDa chain) (Carboxypeptidase N large subunit) (Carboxypeptidase N polypeptide 2) (Carboxypeptidase N regulatory subunit)
• Protein function: The 83 kDa subunit binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	146 → 205	Leucine rich repeat	Repeat
  PF13855	LRR_8	193 → 253	Leucine rich repeat	Repeat
  PF13855	LRR_8	242 → 301	Leucine rich repeat	Repeat
  PF13855	LRR_8	291 → 349	Leucine rich repeat	Repeat
  PF13855	LRR_8	337 → 396	Leucine rich repeat	Repeat

• Sequence:

  MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETS
  FTTLETRAFGSNPNLTKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNL
  TSLGKLTLNFNMLEALPEGLFQHLAALESLHLQGNQLQALPRRLFQPLTHLKTLNLAQNL
  LAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLDSNNISELPPQVFSQL
  FCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQ
  LETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALFQNL
  SKLELLSLSKNQLTTLPEGIFDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNI
  QTYCAGPAYLKGQVVPALNEKQLVCPVTRDHLGFQVTWPDESKAGGSWDLAVQERAARSQ
  CTYSNPEGTVVLACDQAQCRWLNVQLSPQQGSLGLQYNASQEWDLRSSCGSLRLTVSIEA
  RAAGP

• Sequence length: 545

Pathways

Reactome:

Regulation of Complement cascade

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations