Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1365
Gene name	Claudin 3
Gene symbol	CLDN3
Synonyms (NCBI Gene)	C7orf1CPE-R2CPETR2HRVP1RVP1
Chromosome	7
Chromosome location	7q11.23
Summary	Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space.

162

Show/Hide all (162)

miRTarBase ID	miRNA	Experiments
MIRT895355	hsa-miR-1193	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895357	hsa-miR-1287	CLIP-seq
MIRT895358	hsa-miR-1293	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895368	hsa-miR-3119	CLIP-seq
MIRT895369	hsa-miR-3127-3p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895371	hsa-miR-3193	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895374	hsa-miR-3675-5p	CLIP-seq
MIRT895375	hsa-miR-371b-3p	CLIP-seq
MIRT895376	hsa-miR-4267	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895378	hsa-miR-4283	CLIP-seq
MIRT895379	hsa-miR-4287	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT895382	hsa-miR-4446-3p	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT895384	hsa-miR-4466	CLIP-seq
MIRT895385	hsa-miR-4469	CLIP-seq
MIRT895386	hsa-miR-4483	CLIP-seq
MIRT895387	hsa-miR-4488	CLIP-seq
MIRT895388	hsa-miR-4489	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT895391	hsa-miR-4685-3p	CLIP-seq
MIRT895392	hsa-miR-4685-5p	CLIP-seq
MIRT895393	hsa-miR-4694-5p	CLIP-seq
MIRT895394	hsa-miR-4697-5p	CLIP-seq
MIRT895395	hsa-miR-4708-3p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT895397	hsa-miR-4730	CLIP-seq
MIRT895398	hsa-miR-4738-5p	CLIP-seq
MIRT895399	hsa-miR-4746-5p	CLIP-seq
MIRT895400	hsa-miR-4749-3p	CLIP-seq
MIRT895401	hsa-miR-4783-5p	CLIP-seq
MIRT895402	hsa-miR-486-3p	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT895404	hsa-miR-541	CLIP-seq
MIRT895405	hsa-miR-548ad	CLIP-seq
MIRT895406	hsa-miR-548q	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT895408	hsa-miR-615-5p	CLIP-seq
MIRT895409	hsa-miR-654-5p	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT895411	hsa-miR-675	CLIP-seq
MIRT895412	hsa-miR-766	CLIP-seq
MIRT895413	hsa-miR-876-3p	CLIP-seq
MIRT895414	hsa-miR-885-3p	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895355	hsa-miR-1193	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895357	hsa-miR-1287	CLIP-seq
MIRT895358	hsa-miR-1293	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT1965487	hsa-miR-2110	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895369	hsa-miR-3127-3p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895371	hsa-miR-3193	CLIP-seq
MIRT895372	hsa-miR-323-5p	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895374	hsa-miR-3675-5p	CLIP-seq
MIRT895375	hsa-miR-371b-3p	CLIP-seq
MIRT895376	hsa-miR-4267	CLIP-seq
MIRT1965488	hsa-miR-4271	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895378	hsa-miR-4283	CLIP-seq
MIRT895379	hsa-miR-4287	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT895382	hsa-miR-4446-3p	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT895384	hsa-miR-4466	CLIP-seq
MIRT895385	hsa-miR-4469	CLIP-seq
MIRT895386	hsa-miR-4483	CLIP-seq
MIRT895387	hsa-miR-4488	CLIP-seq
MIRT895388	hsa-miR-4489	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT1965489	hsa-miR-4667-5p	CLIP-seq
MIRT895391	hsa-miR-4685-3p	CLIP-seq
MIRT895392	hsa-miR-4685-5p	CLIP-seq
MIRT895393	hsa-miR-4694-5p	CLIP-seq
MIRT895394	hsa-miR-4697-5p	CLIP-seq
MIRT1965490	hsa-miR-4700-5p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT1965491	hsa-miR-4725-3p	CLIP-seq
MIRT1965492	hsa-miR-4731-5p	CLIP-seq
MIRT895398	hsa-miR-4738-5p	CLIP-seq
MIRT895399	hsa-miR-4746-5p	CLIP-seq
MIRT895400	hsa-miR-4749-3p	CLIP-seq
MIRT895401	hsa-miR-4783-5p	CLIP-seq
MIRT895402	hsa-miR-486-3p	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT895406	hsa-miR-548q	CLIP-seq
MIRT1965493	hsa-miR-604	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT895408	hsa-miR-615-5p	CLIP-seq
MIRT1965494	hsa-miR-647	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT895411	hsa-miR-675	CLIP-seq
MIRT895412	hsa-miR-766	CLIP-seq
MIRT895413	hsa-miR-876-3p	CLIP-seq
MIRT895414	hsa-miR-885-3p	CLIP-seq
MIRT895356	hsa-miR-128	CLIP-seq
MIRT895359	hsa-miR-1294	CLIP-seq
MIRT895360	hsa-miR-1297	CLIP-seq
MIRT895361	hsa-miR-133a	CLIP-seq
MIRT895362	hsa-miR-133b	CLIP-seq
MIRT2201437	hsa-miR-1343	CLIP-seq
MIRT2201438	hsa-miR-1587	CLIP-seq
MIRT895363	hsa-miR-26a	CLIP-seq
MIRT895364	hsa-miR-26b	CLIP-seq
MIRT895365	hsa-miR-27a	CLIP-seq
MIRT895366	hsa-miR-27b	CLIP-seq
MIRT895367	hsa-miR-296-5p	CLIP-seq
MIRT895370	hsa-miR-3154	CLIP-seq
MIRT895373	hsa-miR-3665	CLIP-seq
MIRT895377	hsa-miR-4281	CLIP-seq
MIRT895380	hsa-miR-4292	CLIP-seq
MIRT895381	hsa-miR-4308	CLIP-seq
MIRT2201439	hsa-miR-4314	CLIP-seq
MIRT2201440	hsa-miR-4417	CLIP-seq
MIRT895383	hsa-miR-4465	CLIP-seq
MIRT2201441	hsa-miR-4492	CLIP-seq
MIRT2201442	hsa-miR-4498	CLIP-seq
MIRT895389	hsa-miR-455-3p	CLIP-seq
MIRT895390	hsa-miR-4651	CLIP-seq
MIRT2201443	hsa-miR-4656	CLIP-seq
MIRT1965489	hsa-miR-4667-5p	CLIP-seq
MIRT2201444	hsa-miR-4675	CLIP-seq
MIRT1965490	hsa-miR-4700-5p	CLIP-seq
MIRT895396	hsa-miR-4710	CLIP-seq
MIRT895397	hsa-miR-4730	CLIP-seq
MIRT2201445	hsa-miR-4741	CLIP-seq
MIRT895403	hsa-miR-513a-5p	CLIP-seq
MIRT2201446	hsa-miR-516a-3p	CLIP-seq
MIRT895404	hsa-miR-541	CLIP-seq
MIRT895407	hsa-miR-608	CLIP-seq
MIRT2201447	hsa-miR-637	CLIP-seq
MIRT895409	hsa-miR-654-5p	CLIP-seq
MIRT895410	hsa-miR-657	CLIP-seq
MIRT2201448	hsa-miR-762	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SNAI1	Repression	19874710
SP1	Activation	17986852

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEP	15174142
GO:0003382	Process	Epithelial cell morphogenesis	IEA
GO:0003382	Process	Epithelial cell morphogenesis	ISS
GO:0003406	Process	Retinal pigment epithelium development	IMP	27593915
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9334247
GO:0005198	Function	Structural molecule activity	IDA	36008380
GO:0005198	Function	Structural molecule activity	IEA
GO:0005515	Function	Protein binding	IPI	25849148, 28028216, 36008380
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9334247
GO:0005911	Component	Cell-cell junction	IDA	18774778
GO:0005911	Component	Cell-cell junction	IEA
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IDA	25849148
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0007155	Process	Cell adhesion	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	27593915
GO:0010628	Process	Positive regulation of gene expression	IMP	27593915
GO:0010629	Process	Negative regulation of gene expression	IMP	27593915
GO:0014045	Process	Establishment of endothelial blood-brain barrier	IEA
GO:0014045	Process	Establishment of endothelial blood-brain barrier	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9441748
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	IEA
GO:0022604	Process	Regulation of cell morphogenesis	IMP	16103090
GO:0030036	Process	Actin cytoskeleton organization	IMP	27593915
GO:0030335	Process	Positive regulation of cell migration	IMP	16103090
GO:0030336	Process	Negative regulation of cell migration	IMP	27593915
GO:0032991	Component	Protein-containing complex	IDA	25849148
GO:0034329	Process	Cell junction assembly	IMP	27593915
GO:0034331	Process	Cell junction maintenance	IEA
GO:0034331	Process	Cell junction maintenance	ISS
GO:0035633	Process	Maintenance of blood-brain barrier	NAS	30280653
GO:0042802	Function	Identical protein binding	IDA	28028216, 36008380
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	25849148
GO:0043296	Component	Apical junction complex	IMP	27593915
GO:0045217	Process	Cell-cell junction maintenance	IDA	36008380
GO:0045471	Process	Response to ethanol	IEA
GO:0070160	Component	Tight junction	IDA	30734065
GO:0070160	Component	Tight junction	IEA
GO:0070160	Component	Tight junction	IMP	20655293
GO:0070161	Component	Anchoring junction	IEA
GO:0070830	Process	Bicellular tight junction assembly	IBA
GO:0070830	Process	Bicellular tight junction assembly	IMP	20655293, 25849148
GO:0090303	Process	Positive regulation of wound healing	IMP	16103090
GO:0090559	Process	Regulation of membrane permeability	IMP	20655293
GO:0098632	Function	Cell-cell adhesion mediator activity	IDA	27593915
GO:0140459	Process	Response to Gram-positive bacterium	IEA
GO:0150111	Process	Regulation of transepithelial transport	IMP	27593915
GO:2000186	Process	Negative regulation of phosphate transmembrane transport	IDA	36008380

MIM	HGNC	e!Ensembl
602910	2045	ENSG00000165215

O15551

Protein name

Claudin-3 (Clostridium perfringens enterotoxin receptor 2) (CPE-R 2) (CPE-receptor 2) (Rat ventral prostate.1 protein homolog) (hRVP1)

Protein function

Barrier-forming claudin. Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	3 → 180	PMP-22/EMP/MP20/Claudin family	Family

Sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV

Sequence length

220

Interactions

View interactions

	KEGG
	Virion - Hepatitis viruses Cell adhesion molecules Tight junction Leukocyte transendothelial migration Pathogenic Escherichia coli infection Hepatitis C

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATOPIC RHINITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS, ALLERGIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (122)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	16287068, 16540726, 17429687, 17647191, 23385421, 28783170, 29285188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17418912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25935651, 28160565, 29928392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	11691807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	17291259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31209247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	27957319	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	Pubtator	27363029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28396511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	18854598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	39189437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15750830, 22983836, 23702644, 26566278, 29482498, 31307407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15750830, 21883696, 22464177, 23529315, 26919310, 29482498, 31307407, 36412442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33714203	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17291259, 24333468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17647191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	23529315	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25004182, 29511369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17653889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15750830, 18587324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17585317, 24294371, 25820701, 32518268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29511369	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	17291259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19208807, 20598131, 21789222, 22544349, 23685873, 24144916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	LHGDN	17545541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	27446827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	33441949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	30213590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	30213590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	25319490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	30213590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30971956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28193196, 28783170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	24069372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24069372, 28383479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Mucinous Adenocarcinoma	Colorectal Cancer	BEFREE	29285188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16253248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16253248, 21209152, 24069372, 32945502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16287068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	29091813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	34008771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29277540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	29277540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29277540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17326053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18313739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18313739, 18384777, 18850381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18384777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18384777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21789222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	20598131, 21975465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	33638948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19137073	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	29749528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	27446827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	18801625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	23529315, 31044387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	BEFREE	29277540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	Pubtator	17291259	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34162953	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36674626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18955738, 32001212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28056337		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	29749528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31115553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23385421, 25277196, 31053499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31053499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24625834, 29511369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25820701	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15750830, 22983836, 23702644, 26566278, 29482498, 31307407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17326053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25277196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25004182, 29511369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15899825, 17647191, 19208807, 19567823, 20598131, 21519794, 23097631, 23685873, 24144916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20598131, 27629072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11691807, 28396511, 31186785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22290341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15161682, 16836752, 17647191, 21692061, 22983836, 24144916, 25004182, 25277196, 28193196, 28783170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28193196, 28783170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22936447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	28374851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	16505274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25935651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	16505274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	28396511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	29285188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24356983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	31265168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17429687, 17986852, 18477216, 19208807, 20109727, 20598131, 21975465, 24144916, 25277196, 25935651, 26566278, 27943232, 27956521, 28287265, 28396511 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	28545845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	20598131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	20053926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15240533, 15905176, 18439941		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16287068, 18057528, 19208807, 21519794, 23685873, 24144916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15905176, 17986852, 19426958, 20053926, 21255442, 23097631, 30081720, 37418532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	17647191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16836752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11691807, 28396511, 31186785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	11691807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21255442, 39595976	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	30222202, 31120609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	33441633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18955738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	24294371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27687058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	25820701, 29511369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18251778, 18477216, 18996641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 17459057, 24333468, 25755790, 28586067, 29749528, 33761685, 34251747	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17459057		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26820677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	16836752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22638807, 23443971, 24390667, 29482498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28123606, 29482498, 30142017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	16836752	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	23820735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	15785748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	20466674, 9878248		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLDN3 (claudin 3)