Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1364
Gene name	Claudin 4
Gene symbol	CLDN4
Synonyms (NCBI Gene)	CPE-RCPERCPETRCPETR1WBSCR8hCPE-R
Chromosome	7
Chromosome location	7q11.23
Summary	The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This

275

Show/Hide all (275)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017395	hsa-miR-335-5p	Microarray	18185580
MIRT051675	hsa-let-7e-5p	CLASH	23622248
MIRT895415	hsa-miR-124	CLIP-seq
MIRT895416	hsa-miR-1252	CLIP-seq
MIRT895417	hsa-miR-1254	CLIP-seq
MIRT895418	hsa-miR-127-5p	CLIP-seq
MIRT895419	hsa-miR-1291	CLIP-seq
MIRT895420	hsa-miR-1910	CLIP-seq
MIRT895421	hsa-miR-1914	CLIP-seq
MIRT895422	hsa-miR-1915	CLIP-seq
MIRT895423	hsa-miR-2116	CLIP-seq
MIRT895424	hsa-miR-298	CLIP-seq
MIRT895425	hsa-miR-3074-5p	CLIP-seq
MIRT895426	hsa-miR-3116	CLIP-seq
MIRT895427	hsa-miR-3150b-3p	CLIP-seq
MIRT895428	hsa-miR-3155	CLIP-seq
MIRT895429	hsa-miR-3155b	CLIP-seq
MIRT895430	hsa-miR-3179	CLIP-seq
MIRT895431	hsa-miR-3189-3p	CLIP-seq
MIRT895432	hsa-miR-3202	CLIP-seq
MIRT895433	hsa-miR-3591-5p	CLIP-seq
MIRT895434	hsa-miR-3664-5p	CLIP-seq
MIRT895435	hsa-miR-3667-3p	CLIP-seq
MIRT895436	hsa-miR-3674	CLIP-seq
MIRT895437	hsa-miR-3689a-5p	CLIP-seq
MIRT895438	hsa-miR-3689b	CLIP-seq
MIRT895439	hsa-miR-3689e	CLIP-seq
MIRT895440	hsa-miR-3689f	CLIP-seq
MIRT895441	hsa-miR-382	CLIP-seq
MIRT895442	hsa-miR-3922-5p	CLIP-seq
MIRT895443	hsa-miR-3925-3p	CLIP-seq
MIRT895444	hsa-miR-3928	CLIP-seq
MIRT895445	hsa-miR-4257	CLIP-seq
MIRT895446	hsa-miR-4264	CLIP-seq
MIRT895447	hsa-miR-4292	CLIP-seq
MIRT895448	hsa-miR-4297	CLIP-seq
MIRT895449	hsa-miR-4435	CLIP-seq
MIRT895450	hsa-miR-4459	CLIP-seq
MIRT895451	hsa-miR-4493	CLIP-seq
MIRT895452	hsa-miR-4522	CLIP-seq
MIRT895453	hsa-miR-4530	CLIP-seq
MIRT895454	hsa-miR-4533	CLIP-seq
MIRT895455	hsa-miR-455-3p	CLIP-seq
MIRT895456	hsa-miR-4640-5p	CLIP-seq
MIRT895457	hsa-miR-4677-5p	CLIP-seq
MIRT895458	hsa-miR-4685-5p	CLIP-seq
MIRT895459	hsa-miR-4688	CLIP-seq
MIRT895460	hsa-miR-4690-5p	CLIP-seq
MIRT895461	hsa-miR-4695-5p	CLIP-seq
MIRT895462	hsa-miR-4708-3p	CLIP-seq
MIRT895463	hsa-miR-4708-5p	CLIP-seq
MIRT895464	hsa-miR-4715-3p	CLIP-seq
MIRT895465	hsa-miR-4722-3p	CLIP-seq
MIRT895466	hsa-miR-4722-5p	CLIP-seq
MIRT895467	hsa-miR-4726-3p	CLIP-seq
MIRT895468	hsa-miR-4726-5p	CLIP-seq
MIRT895469	hsa-miR-4729	CLIP-seq
MIRT895470	hsa-miR-4733-5p	CLIP-seq
MIRT895471	hsa-miR-4747-5p	CLIP-seq
MIRT895472	hsa-miR-4778-3p	CLIP-seq
MIRT895473	hsa-miR-4779	CLIP-seq
MIRT895474	hsa-miR-4784	CLIP-seq
MIRT895475	hsa-miR-4786-3p	CLIP-seq
MIRT895476	hsa-miR-4792	CLIP-seq
MIRT895477	hsa-miR-484	CLIP-seq
MIRT895478	hsa-miR-486-3p	CLIP-seq
MIRT895479	hsa-miR-506	CLIP-seq
MIRT895480	hsa-miR-520a-5p	CLIP-seq
MIRT895481	hsa-miR-520d-5p	CLIP-seq
MIRT895482	hsa-miR-524-5p	CLIP-seq
MIRT895483	hsa-miR-525-5p	CLIP-seq
MIRT895484	hsa-miR-582-5p	CLIP-seq
MIRT895485	hsa-miR-617	CLIP-seq
MIRT895486	hsa-miR-621	CLIP-seq
MIRT895487	hsa-miR-622	CLIP-seq
MIRT895488	hsa-miR-661	CLIP-seq
MIRT895489	hsa-miR-766	CLIP-seq
MIRT895490	hsa-miR-922	CLIP-seq
MIRT895491	hsa-miR-941	CLIP-seq
MIRT1965495	hsa-miR-10a	CLIP-seq
MIRT1965496	hsa-miR-10b	CLIP-seq
MIRT895415	hsa-miR-124	CLIP-seq
MIRT895416	hsa-miR-1252	CLIP-seq
MIRT895417	hsa-miR-1254	CLIP-seq
MIRT1965497	hsa-miR-1285	CLIP-seq
MIRT895419	hsa-miR-1291	CLIP-seq
MIRT1965498	hsa-miR-1343	CLIP-seq
MIRT895420	hsa-miR-1910	CLIP-seq
MIRT895421	hsa-miR-1914	CLIP-seq
MIRT1965499	hsa-miR-2277-5p	CLIP-seq
MIRT895424	hsa-miR-298	CLIP-seq
MIRT895425	hsa-miR-3074-5p	CLIP-seq
MIRT895426	hsa-miR-3116	CLIP-seq
MIRT1965500	hsa-miR-3148	CLIP-seq
MIRT895427	hsa-miR-3150b-3p	CLIP-seq
MIRT1965501	hsa-miR-3176	CLIP-seq
MIRT1965502	hsa-miR-3178	CLIP-seq
MIRT895430	hsa-miR-3179	CLIP-seq
MIRT1965503	hsa-miR-3183	CLIP-seq
MIRT1965504	hsa-miR-3191	CLIP-seq
MIRT895432	hsa-miR-3202	CLIP-seq
MIRT1965505	hsa-miR-326	CLIP-seq
MIRT1965506	hsa-miR-330-5p	CLIP-seq
MIRT1965507	hsa-miR-339-5p	CLIP-seq
MIRT1965508	hsa-miR-3620	CLIP-seq
MIRT895435	hsa-miR-3667-3p	CLIP-seq
MIRT895436	hsa-miR-3674	CLIP-seq
MIRT895437	hsa-miR-3689a-5p	CLIP-seq
MIRT895438	hsa-miR-3689b	CLIP-seq
MIRT895439	hsa-miR-3689e	CLIP-seq
MIRT895440	hsa-miR-3689f	CLIP-seq
MIRT1965509	hsa-miR-3922-3p	CLIP-seq
MIRT895442	hsa-miR-3922-5p	CLIP-seq
MIRT895443	hsa-miR-3925-3p	CLIP-seq
MIRT895444	hsa-miR-3928	CLIP-seq
MIRT895445	hsa-miR-4257	CLIP-seq
MIRT895446	hsa-miR-4264	CLIP-seq
MIRT1965510	hsa-miR-4267	CLIP-seq
MIRT1965511	hsa-miR-4286	CLIP-seq
MIRT895447	hsa-miR-4292	CLIP-seq
MIRT895448	hsa-miR-4297	CLIP-seq
MIRT895449	hsa-miR-4435	CLIP-seq
MIRT1965512	hsa-miR-4486	CLIP-seq
MIRT895451	hsa-miR-4493	CLIP-seq
MIRT895453	hsa-miR-4530	CLIP-seq
MIRT895454	hsa-miR-4533	CLIP-seq
MIRT1965513	hsa-miR-4537	CLIP-seq
MIRT895455	hsa-miR-455-3p	CLIP-seq
MIRT895458	hsa-miR-4685-5p	CLIP-seq
MIRT895459	hsa-miR-4688	CLIP-seq
MIRT895462	hsa-miR-4708-3p	CLIP-seq
MIRT895463	hsa-miR-4708-5p	CLIP-seq
MIRT895465	hsa-miR-4722-3p	CLIP-seq
MIRT1965514	hsa-miR-4723-3p	CLIP-seq
MIRT895469	hsa-miR-4729	CLIP-seq
MIRT895470	hsa-miR-4733-5p	CLIP-seq
MIRT1965515	hsa-miR-4736	CLIP-seq
MIRT895472	hsa-miR-4778-3p	CLIP-seq
MIRT895474	hsa-miR-4784	CLIP-seq
MIRT895475	hsa-miR-4786-3p	CLIP-seq
MIRT895476	hsa-miR-4792	CLIP-seq
MIRT895478	hsa-miR-486-3p	CLIP-seq
MIRT895479	hsa-miR-506	CLIP-seq
MIRT895481	hsa-miR-520d-5p	CLIP-seq
MIRT1965516	hsa-miR-522	CLIP-seq
MIRT895482	hsa-miR-524-5p	CLIP-seq
MIRT895484	hsa-miR-582-5p	CLIP-seq
MIRT895487	hsa-miR-622	CLIP-seq
MIRT895488	hsa-miR-661	CLIP-seq
MIRT1965517	hsa-miR-668	CLIP-seq
MIRT895489	hsa-miR-766	CLIP-seq
MIRT895490	hsa-miR-922	CLIP-seq
MIRT895491	hsa-miR-941	CLIP-seq
MIRT1965495	hsa-miR-10a	CLIP-seq
MIRT1965496	hsa-miR-10b	CLIP-seq
MIRT2201449	hsa-miR-1207-5p	CLIP-seq
MIRT895415	hsa-miR-124	CLIP-seq
MIRT2201450	hsa-miR-1247	CLIP-seq
MIRT895418	hsa-miR-127-5p	CLIP-seq
MIRT1965497	hsa-miR-1285	CLIP-seq
MIRT2201451	hsa-miR-1293	CLIP-seq
MIRT1965498	hsa-miR-1343	CLIP-seq
MIRT2201452	hsa-miR-1470	CLIP-seq
MIRT2201453	hsa-miR-1539	CLIP-seq
MIRT895420	hsa-miR-1910	CLIP-seq
MIRT2201454	hsa-miR-1913	CLIP-seq
MIRT895422	hsa-miR-1915	CLIP-seq
MIRT895423	hsa-miR-2116	CLIP-seq
MIRT1965499	hsa-miR-2277-5p	CLIP-seq
MIRT2201455	hsa-miR-2355-5p	CLIP-seq
MIRT895424	hsa-miR-298	CLIP-seq
MIRT2201456	hsa-miR-3065-3p	CLIP-seq
MIRT2201457	hsa-miR-3130-3p	CLIP-seq
MIRT895427	hsa-miR-3150b-3p	CLIP-seq
MIRT895428	hsa-miR-3155	CLIP-seq
MIRT895429	hsa-miR-3155b	CLIP-seq
MIRT1965501	hsa-miR-3176	CLIP-seq
MIRT1965502	hsa-miR-3178	CLIP-seq
MIRT1965503	hsa-miR-3183	CLIP-seq
MIRT895431	hsa-miR-3189-3p	CLIP-seq
MIRT2201458	hsa-miR-324-3p	CLIP-seq
MIRT1965505	hsa-miR-326	CLIP-seq
MIRT1965506	hsa-miR-330-5p	CLIP-seq
MIRT1965507	hsa-miR-339-5p	CLIP-seq
MIRT895433	hsa-miR-3591-5p	CLIP-seq
MIRT2201459	hsa-miR-361-3p	CLIP-seq
MIRT1965508	hsa-miR-3620	CLIP-seq
MIRT895434	hsa-miR-3664-5p	CLIP-seq
MIRT2201460	hsa-miR-3665	CLIP-seq
MIRT2201461	hsa-miR-3670	CLIP-seq
MIRT895437	hsa-miR-3689a-5p	CLIP-seq
MIRT895438	hsa-miR-3689b	CLIP-seq
MIRT895439	hsa-miR-3689e	CLIP-seq
MIRT895440	hsa-miR-3689f	CLIP-seq
MIRT895441	hsa-miR-382	CLIP-seq
MIRT2201462	hsa-miR-3918	CLIP-seq
MIRT1965509	hsa-miR-3922-3p	CLIP-seq
MIRT895442	hsa-miR-3922-5p	CLIP-seq
MIRT895444	hsa-miR-3928	CLIP-seq
MIRT895445	hsa-miR-4257	CLIP-seq
MIRT895446	hsa-miR-4264	CLIP-seq
MIRT1965510	hsa-miR-4267	CLIP-seq
MIRT1965511	hsa-miR-4286	CLIP-seq
MIRT2201463	hsa-miR-4290	CLIP-seq
MIRT895447	hsa-miR-4292	CLIP-seq
MIRT2201464	hsa-miR-4313	CLIP-seq
MIRT2201465	hsa-miR-4325	CLIP-seq
MIRT895449	hsa-miR-4435	CLIP-seq
MIRT895450	hsa-miR-4459	CLIP-seq
MIRT2201466	hsa-miR-4483	CLIP-seq
MIRT1965512	hsa-miR-4486	CLIP-seq
MIRT895451	hsa-miR-4493	CLIP-seq
MIRT895452	hsa-miR-4522	CLIP-seq
MIRT895453	hsa-miR-4530	CLIP-seq
MIRT895455	hsa-miR-455-3p	CLIP-seq
MIRT2201467	hsa-miR-4645-5p	CLIP-seq
MIRT2201468	hsa-miR-4663	CLIP-seq
MIRT2201469	hsa-miR-4667-3p	CLIP-seq
MIRT2201470	hsa-miR-4673	CLIP-seq
MIRT2201471	hsa-miR-4676-5p	CLIP-seq
MIRT895457	hsa-miR-4677-5p	CLIP-seq
MIRT895458	hsa-miR-4685-5p	CLIP-seq
MIRT895460	hsa-miR-4690-5p	CLIP-seq
MIRT895461	hsa-miR-4695-5p	CLIP-seq
MIRT895462	hsa-miR-4708-3p	CLIP-seq
MIRT895463	hsa-miR-4708-5p	CLIP-seq
MIRT895464	hsa-miR-4715-3p	CLIP-seq
MIRT895465	hsa-miR-4722-3p	CLIP-seq
MIRT895466	hsa-miR-4722-5p	CLIP-seq
MIRT1965514	hsa-miR-4723-3p	CLIP-seq
MIRT895467	hsa-miR-4726-3p	CLIP-seq
MIRT895469	hsa-miR-4729	CLIP-seq
MIRT895470	hsa-miR-4733-5p	CLIP-seq
MIRT1965515	hsa-miR-4736	CLIP-seq
MIRT895471	hsa-miR-4747-5p	CLIP-seq
MIRT2201472	hsa-miR-4749-3p	CLIP-seq
MIRT2201473	hsa-miR-4763-3p	CLIP-seq
MIRT895473	hsa-miR-4779	CLIP-seq
MIRT895474	hsa-miR-4784	CLIP-seq
MIRT895475	hsa-miR-4786-3p	CLIP-seq
MIRT895476	hsa-miR-4792	CLIP-seq
MIRT2201474	hsa-miR-4793-3p	CLIP-seq
MIRT895477	hsa-miR-484	CLIP-seq
MIRT895479	hsa-miR-506	CLIP-seq
MIRT895480	hsa-miR-520a-5p	CLIP-seq
MIRT895483	hsa-miR-525-5p	CLIP-seq
MIRT2201475	hsa-miR-541	CLIP-seq
MIRT2201476	hsa-miR-548ac	CLIP-seq
MIRT2201477	hsa-miR-548d-3p	CLIP-seq
MIRT2201478	hsa-miR-548z	CLIP-seq
MIRT2201479	hsa-miR-575	CLIP-seq
MIRT2201480	hsa-miR-593	CLIP-seq
MIRT2201481	hsa-miR-596	CLIP-seq
MIRT2201482	hsa-miR-615-5p	CLIP-seq
MIRT895485	hsa-miR-617	CLIP-seq
MIRT895486	hsa-miR-621	CLIP-seq
MIRT895487	hsa-miR-622	CLIP-seq
MIRT2201483	hsa-miR-654-5p	CLIP-seq
MIRT1965517	hsa-miR-668	CLIP-seq
MIRT895490	hsa-miR-922	CLIP-seq
MIRT2201484	hsa-miR-940	CLIP-seq
MIRT895491	hsa-miR-941	CLIP-seq
MIRT2201453	hsa-miR-1539	CLIP-seq
MIRT895420	hsa-miR-1910	CLIP-seq
MIRT895423	hsa-miR-2116	CLIP-seq
MIRT895434	hsa-miR-3664-5p	CLIP-seq
MIRT2201461	hsa-miR-3670	CLIP-seq
MIRT895444	hsa-miR-3928	CLIP-seq
MIRT895446	hsa-miR-4264	CLIP-seq
MIRT895452	hsa-miR-4522	CLIP-seq
MIRT895455	hsa-miR-455-3p	CLIP-seq
MIRT2201468	hsa-miR-4663	CLIP-seq
MIRT895457	hsa-miR-4677-5p	CLIP-seq
MIRT895458	hsa-miR-4685-5p	CLIP-seq
MIRT895486	hsa-miR-621	CLIP-seq

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9334247
GO:0005198	Function	Structural molecule activity	IEA
GO:0005254	Function	Chloride channel activity	IEA
GO:0005515	Function	Protein binding	IPI	27647526, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	20375010
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	23407391
GO:0005886	Component	Plasma membrane	TAS	9334247
GO:0005911	Component	Cell-cell junction	IDA	18774778
GO:0005923	Component	Bicellular tight junction	IBA
GO:0005923	Component	Bicellular tight junction	IDA	23407391
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005923	Component	Bicellular tight junction	ISS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006821	Process	Chloride transport	IEA
GO:0007155	Process	Cell adhesion	IBA
GO:0007565	Process	Female pregnancy	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009925	Component	Basal plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016327	Component	Apicolateral plasma membrane	IEA
GO:0016328	Component	Lateral plasma membrane	IEA
GO:0016338	Process	Calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	ISS
GO:0022604	Process	Regulation of cell morphogenesis	IMP	16103090
GO:0030335	Process	Positive regulation of cell migration	IMP	16103090
GO:0032570	Process	Response to progesterone	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034707	Component	Chloride channel complex	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0061436	Process	Establishment of skin barrier	IMP	23407391
GO:0070160	Component	Tight junction	IDA	30734065
GO:0070161	Component	Anchoring junction	IEA
GO:0070293	Process	Renal absorption	ISS
GO:0070830	Process	Bicellular tight junction assembly	IBA
GO:0090303	Process	Positive regulation of wound healing	IMP	16103090
GO:0160184	Process	Paracellular transport	ISS
GO:1902476	Process	Chloride transmembrane transport	IEA

MIM	HGNC	e!Ensembl
602909	2046	ENSG00000189143

O14493

Protein name

Claudin-4 (Clostridium perfringens enterotoxin receptor) (CPE-R) (CPE-receptor) (Williams-Beuren syndrome chromosomal region 8 protein)

Protein function

Can associate with other claudins to regulate tight junction structural and functional strand dynamics (PubMed:35773259, PubMed:36008380). May coassemble with CLDN8 into tight junction strands containing anion-selective channels that convey para

PDB

5B2G , 7KP4 , 7TDM , 7TDN , 8U4V , 8U5B , 9CMH , 9CMI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00822	PMP22_Claudin	4 → 181	PMP-22/EMP/MP20/Claudin family	Family

Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV
AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCNCPPRTDKPYSAKYSAARSAAASNYV

Sequence length

209

Interactions

View interactions

	KEGG
	Virion - Hepatitis viruses Cell adhesion molecules Tight junction Leukocyte transendothelial migration Pathogenic Escherichia coli infection Hepatitis C

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL, BREAST	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (178)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	27466164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16287068, 17647191, 19390931, 21102412, 23385421, 30354850, 31390089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17418912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25935651, 30329165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	17291259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	15693851, 21102412		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	15753385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	30899365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	31473941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21837532, 28099249, 28842811, 30171177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29178675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	16540726, 24603403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	16287068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	18854598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	16439986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasm	Biliary Tract Neoplasm	LHGDN	16439986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	16439986, 18854598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16829686, 27520378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	36293204	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15743508, 18752049, 19142967, 21883696, 23702644, 25871476, 26058359, 26566278, 30808546, 31572543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15743508, 18752049, 20086175, 21883696, 22464177, 25417118, 25871476, 26919310, 36412441, 36412442, 36691073, 37059993, 37465316	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	33714203	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	15743508, 15800679, 17291259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15693851, 15743508, 15820559, 16829686, 18752049, 28084340, 28193196, 29671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28084340, 29671892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	18752049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	16439986, 23385421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16829686, 27520378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27424491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17653889, 30606772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21102412	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29045505	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31751681, 37653791, 37762031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17585317, 33045147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	17291259, 29671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	31390089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17460774, 17647191, 17678893, 19657234, 21123456, 21541062, 21789222, 22544349, 25164128, 27724921, 28481779, 30606772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31498559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	LHGDN	17545541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	29671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29444370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24586698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic intestinal pseudo-obstruction	Intestinal Pseudoobstruction	BEFREE	31144425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30971956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32164249	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28193196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23385421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28381183, 30647838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16253248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16253248, 25038829, 28381183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	16287068		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	21352500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Darier Disease	Darier disease	Pubtator	37496039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30400733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26319240	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37734479	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	26319240, 28856683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24304426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24304426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23552671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37621953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26319240, 28856683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	23095775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17326053, 29671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	18313739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18313739, 18384777, 18850381, 23095775, 29671892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18384777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	18384777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	29276042	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	17460774, 21789222, 30606772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	28084340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22668877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22668877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36070895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28529587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	18854598, 40527859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	29558791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	11522752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28552914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35418179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28552914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35418179	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28084340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	BEFREE	20466674		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	Pubtator	17291259	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	18955738, 32001212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18711353, 23946598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	23946598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	23822740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	38415551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	18490072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	27445342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16439986, 23385421, 24815833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	16439986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	27424491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	24737010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	27904960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	BEFREE	26729015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18752049, 19142967, 21883696, 23702644, 25417118, 25871476, 26058359, 26566278, 30808546, 31572543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17326053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22668877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	16439986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27424491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15899825, 17647191, 17678893, 19555390, 19567823, 19657234, 21541062, 23097631, 25164128, 27724921, 28481779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11522752, 14559813, 22800288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11691807, 18648369, 23686669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17459057, 19390931, 28534362, 28819095, 31040910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	27520378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15820559, 16319398, 17460774, 17647191, 19657234, 20599713, 22286027, 23563899, 26058359, 27424491, 28415141, 28842811, 30474874, 30903651, 31632466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19142967, 22936447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19142967		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31390089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meniere Disease	Meniere Disease	BEFREE	28374851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	16505274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	25935651, 30354850, 31390089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	16505274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18648369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	23822740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	30620087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25778318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	23470164, 29276042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15693851, 16439986, 17429687, 17585317, 18477216, 19142967, 19390931, 20109727, 21102412, 22286027, 23097631, 23390516, 23563899, 24815833, 25417118 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	17709988, 18827820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	17709988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27424491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	20505168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	28481779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16714763, 20053926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16714763		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17678893, 19657234, 21541062, 25164128, 27724921, 30606772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	15277215, 15905176, 16714763, 17653889, 17678893, 17986852, 19619303, 20053926, 21541062, 23097631, 28084340, 28481779, 30606772, 32779991, 35373300, 37057131, 38238671 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	17647191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11522752, 14559813, 22800288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	15693851, 21837532, 28842811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14559813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	12000726, 16836752, 21102412, 21573709, 26028104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal Nonkinesigenic Dyskinesia 1	Paroxysmal nonkinesigenic dyskinesia	BEFREE	31498559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21411543	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	11691807, 18648369, 23686669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	18648369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18648369, 23686669, 36749655	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	30125539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28084340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	18955738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28084340, 29671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	28084340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	17060315, 28084340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septic Toxemia	Septic Toxemia	BEFREE	24304426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	37734479	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	24294371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	28084340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17418912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23563899, 27687058, 29447921, 31257482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	20839069, 24737010, 31632466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23563899	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23856835, 36232536	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	18251778, 18477216, 18996641, 19390931, 28534362, 28819095, 31040910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15643498, 16969486, 17459057, 18283635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17459057, 21844869, 23822740, 25755790, 28534362, 32816956	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17962811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	16836752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22638807, 23443971, 24390667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	19120888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	28084340, 29671892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	16836752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35742959	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38415551	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	15785748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Williams Syndrome	Williams Syndrome	BEFREE	20466674, 9878248		★★★★★ ★☆☆☆☆ Found in Text Mining only

CLDN4 (claudin 4)