KLF14 (KLF transcription factor 14)

Gene

• Entrez ID: 136259
• Gene name: KLF transcription factor 14
• Gene symbol: KLF14
• Synonyms (NCBI Gene): BTEB5
• Chromosome: 7
• Chromosome location: 7q32.2
• Summary: This intronless gene encodes a member of the Kruppel-like family of transcription factors. The encoded protein functions as a transcriptional co-repressor, and is induced by transforming growth factor-beta (TGF-beta) to repress TGF-beta receptor II gene e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT051059	hsa-miR-16-5p	CLASH	23622248
MIRT047783	hsa-miR-30d-5p	CLASH	23622248
MIRT043907	hsa-miR-378a-3p	CLASH	23622248
MIRT735836	hsa-miR-374a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32799891
MIRT1096203	hsa-miR-3121-3p	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921244	hsa-miR-4269	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921246	hsa-miR-4514	CLIP-seq
MIRT1921247	hsa-miR-4692	CLIP-seq
MIRT1921248	hsa-miR-4742-5p	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT2025972	hsa-miR-1229	CLIP-seq
MIRT2025973	hsa-miR-4268	CLIP-seq
MIRT1921244	hsa-miR-4269	CLIP-seq
MIRT2025974	hsa-miR-4300	CLIP-seq
MIRT1921246	hsa-miR-4514	CLIP-seq
MIRT1921247	hsa-miR-4692	CLIP-seq
MIRT1921248	hsa-miR-4742-5p	CLIP-seq
MIRT2025975	hsa-miR-4757-5p	CLIP-seq
MIRT2025976	hsa-miR-920	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT1921241	hsa-miR-145	CLIP-seq
MIRT2430451	hsa-miR-23a	CLIP-seq
MIRT2430452	hsa-miR-23b	CLIP-seq
MIRT2430453	hsa-miR-23c	CLIP-seq
MIRT1921242	hsa-miR-3200-5p	CLIP-seq
MIRT1921243	hsa-miR-4251	CLIP-seq
MIRT1921245	hsa-miR-4329	CLIP-seq
MIRT1921249	hsa-miR-580	CLIP-seq
MIRT2452626	hsa-miR-2392	CLIP-seq
MIRT2452627	hsa-miR-3153	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	23332764
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24759103
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	24759103
GO:0046872	Function	Metal ion binding	IEA
GO:1902070	Process	Positive regulation of sphingolipid mediated signaling pathway	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 609393
• HGNC: 23025
• e!Ensembl: ENSG00000266265

Protein

• UniProt ID: Q8TD94
• Protein name: Krueppel-like factor 14 (Basic transcription element-binding protein 5) (BTE-binding protein 5) (Transcription factor BTEB5)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00096	zf-C2H2	195 → 219	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	225 → 249	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	255 → 277	Zinc finger, C2H2 type	Domain

• Sequence:

  MSAAVACLDYFAAECLVSMSAGAVVHRRPPDPEGAGGAAGSEVGAAPPESALPGPGPPGP
  ASVPQLPQVPAPSPGAGGAAPHLLAASVWADLRGSSGEGSWENSGEAPRASSGFSDPIPC
  SVQTPCSELAPASGAAAVCAPESSSDAPAVPSAPAAPGAPAASGGFSGGALGAGPAPAAD
  QAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSD
  ELARHYRTHTGEKRFSCPLCPKQFSRSDHLTKHARRHPTYHPDMIEYRGRRRTPRIDPPL
  TSEVESSASGSGPGPAPSFTTCL

• Sequence length: 323

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLIPIDEMIAS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KLF14-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	29849909	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease type 1	Alzheimer disease	Pubtator	29849909	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	28725932		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26368306, 27923151, 28641818, 31518965		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26368306, 27923151, 28641818, 31518965		★☆☆☆☆ Found in Text Mining only
Autoimmune Chronic Hepatitis	Autoimmune hepatitis	BEFREE	30254317		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	35577881	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30745849	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37997542	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	19578363		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28641818, 30248551		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	37351102	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28423541		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28423541	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30745849	Inhibit	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26368306		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26368306, 30248551		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26368306, 30248551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	BEFREE	26368306, 30248551		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26670163		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26670163		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	26670163	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21572415, 22791750, 23630301, 26599349, 26670163, 26927145, 37351102	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21350842, 21572415, 22046406, 23193183, 23630301, 24486580, 26226221, 26599349, 26670163, 26927145, 27923151, 28641818, 28962896, 29123026, 29425818, 29632379, 29880058, 30087441		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	29632379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	BEFREE	26368306, 29632379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	CTD_human_DG	29632379		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyslipidemias	Dyslipidemias	Pubtator	37351102	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	35577881	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	26368306		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	26226221		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26599349	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22791750, 35456983, 37351102	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver carcinoma	Liver carcinoma	BEFREE	30216442		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26439168		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26439168		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	21572415		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	21572415	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35168826, 35456983, 40243421	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26368306, 28962896, 31589552		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26439168, 30400002		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29425818		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35456983	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25119587	Associate	★☆☆☆☆ Found in Text Mining only