Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	136
Gene name	Adenosine A2b receptor
Gene symbol	ADORA2B
Synonyms (NCBI Gene)	ADORA2
Chromosome	17
Chromosome location	17p12
Summary	This gene encodes an adenosine receptor that is a member of the G protein-coupled receptor superfamily. This integral membrane protein stimulates adenylate cyclase activity in the presence of adenosine. This protein also interacts with netrin-1, which is

229

Show/Hide all (229)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004499	hsa-miR-27b-3p	qRT-PCRLuciferase reporter assay	20388705
MIRT559721	hsa-miR-3681-3p	PAR-CLIP	21572407
MIRT559720	hsa-miR-216a-3p	PAR-CLIP	21572407
MIRT004499	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT076088	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT035581	hsa-miR-128-3p	PAR-CLIP	21572407
MIRT076091	hsa-miR-452-5p	PAR-CLIP	21572407
MIRT076119	hsa-miR-4676-3p	PAR-CLIP	21572407
MIRT076127	hsa-miR-892c-3p	PAR-CLIP	21572407
MIRT559719	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT076103	hsa-miR-1208	PAR-CLIP	21572407
MIRT116052	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT076090	hsa-miR-377-3p	PAR-CLIP	21572407
MIRT076092	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT559718	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT116049	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT116050	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT116051	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT482422	hsa-miR-944	PAR-CLIP	23592263
MIRT482421	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	23592263
MIRT482415	hsa-miR-5095	PAR-CLIP	23592263
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT035581	hsa-miR-128-3p	Luciferase reporter assayqRT-PCRWestern blot	26478435
MIRT035581	hsa-miR-128-3p	Luciferase reporter assayqRT-PCRWestern blot	26478435
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	26701625
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	26701625
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	26701625
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	26701625
MIRT482415	hsa-miR-5095	PAR-CLIP	26701625
MIRT482415	hsa-miR-5095	PAR-CLIP	26701625
MIRT482421	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT482421	hsa-miR-552-3p	PAR-CLIP	26701625
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	26701625
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	26701625
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	26701625
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	26701625
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	26701625
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	26701625
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	26701625
MIRT482422	hsa-miR-944	PAR-CLIP	26701625
MIRT482422	hsa-miR-944	PAR-CLIP	26701625
MIRT559721	hsa-miR-3681-3p	PAR-CLIP	21572407
MIRT559720	hsa-miR-216a-3p	PAR-CLIP	21572407
MIRT004499	hsa-miR-27b-3p	PAR-CLIP	21572407
MIRT076088	hsa-miR-27a-3p	PAR-CLIP	21572407
MIRT035581	hsa-miR-128-3p	PAR-CLIP	21572407
MIRT076091	hsa-miR-452-5p	PAR-CLIP	21572407
MIRT076119	hsa-miR-4676-3p	PAR-CLIP	21572407
MIRT076127	hsa-miR-892c-3p	PAR-CLIP	21572407
MIRT559719	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT076103	hsa-miR-1208	PAR-CLIP	21572407
MIRT116052	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT076090	hsa-miR-377-3p	PAR-CLIP	21572407
MIRT076092	hsa-miR-513a-5p	PAR-CLIP	21572407
MIRT559718	hsa-miR-222-5p	PAR-CLIP	21572407
MIRT116049	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT116050	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT116051	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT482422	hsa-miR-944	PAR-CLIP	23592263
MIRT482421	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT482420	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT482419	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT482418	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT482417	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT482416	hsa-miR-6850-3p	PAR-CLIP	23592263
MIRT482415	hsa-miR-5095	PAR-CLIP	23592263
MIRT482414	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT482413	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT769598	hsa-miR-128	CLIP-seq
MIRT769599	hsa-miR-2052	CLIP-seq
MIRT769600	hsa-miR-27a	CLIP-seq
MIRT769601	hsa-miR-27b	CLIP-seq
MIRT769602	hsa-miR-3189-3p	CLIP-seq
MIRT769603	hsa-miR-33a	CLIP-seq
MIRT769604	hsa-miR-33b	CLIP-seq
MIRT769605	hsa-miR-3545-3p	CLIP-seq
MIRT769606	hsa-miR-362-5p	CLIP-seq
MIRT769607	hsa-miR-369-3p	CLIP-seq
MIRT769608	hsa-miR-374a	CLIP-seq
MIRT769609	hsa-miR-374b	CLIP-seq
MIRT769610	hsa-miR-377	CLIP-seq
MIRT769611	hsa-miR-432	CLIP-seq
MIRT769612	hsa-miR-4454	CLIP-seq
MIRT769613	hsa-miR-452	CLIP-seq
MIRT769614	hsa-miR-4528	CLIP-seq
MIRT769615	hsa-miR-4680-5p	CLIP-seq
MIRT769616	hsa-miR-4763-5p	CLIP-seq
MIRT769617	hsa-miR-4775	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT769619	hsa-miR-500a	CLIP-seq
MIRT769620	hsa-miR-500b	CLIP-seq
MIRT769621	hsa-miR-548l	CLIP-seq
MIRT769622	hsa-miR-548n	CLIP-seq
MIRT769623	hsa-miR-590-3p	CLIP-seq
MIRT769624	hsa-miR-633	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT769616	hsa-miR-4763-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT2167921	hsa-miR-106a	CLIP-seq
MIRT2167922	hsa-miR-106b	CLIP-seq
MIRT2167923	hsa-miR-17	CLIP-seq
MIRT2167924	hsa-miR-20a	CLIP-seq
MIRT2167925	hsa-miR-20b	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2167933	hsa-miR-512-3p	CLIP-seq
MIRT2167934	hsa-miR-519d	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT2167940	hsa-miR-520g	CLIP-seq
MIRT2167941	hsa-miR-520h	CLIP-seq
MIRT2167942	hsa-miR-93	CLIP-seq
MIRT2383956	hsa-miR-1827	CLIP-seq
MIRT2383957	hsa-miR-2682	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2383958	hsa-miR-335	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2383959	hsa-miR-449c	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT2383960	hsa-miR-455-3p	CLIP-seq
MIRT2383961	hsa-miR-4685-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT2443276	hsa-miR-1976	CLIP-seq
MIRT2443277	hsa-miR-3690	CLIP-seq
MIRT2443278	hsa-miR-4254	CLIP-seq
MIRT2443279	hsa-miR-4279	CLIP-seq
MIRT2443280	hsa-miR-7	CLIP-seq
MIRT2167921	hsa-miR-106a	CLIP-seq
MIRT2167922	hsa-miR-106b	CLIP-seq
MIRT2470436	hsa-miR-1287	CLIP-seq
MIRT2470437	hsa-miR-1294	CLIP-seq
MIRT2470438	hsa-miR-150	CLIP-seq
MIRT2167923	hsa-miR-17	CLIP-seq
MIRT2383956	hsa-miR-1827	CLIP-seq
MIRT2167924	hsa-miR-20a	CLIP-seq
MIRT2167925	hsa-miR-20b	CLIP-seq
MIRT2383957	hsa-miR-2682	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2470439	hsa-miR-3135b	CLIP-seq
MIRT2383958	hsa-miR-335	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2470440	hsa-miR-3909	CLIP-seq
MIRT2470441	hsa-miR-4312	CLIP-seq
MIRT2470442	hsa-miR-4316	CLIP-seq
MIRT2383959	hsa-miR-449c	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT2383960	hsa-miR-455-3p	CLIP-seq
MIRT2383961	hsa-miR-4685-5p	CLIP-seq
MIRT2470443	hsa-miR-4757-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT2470444	hsa-miR-502-5p	CLIP-seq
MIRT2167933	hsa-miR-512-3p	CLIP-seq
MIRT2470445	hsa-miR-513b	CLIP-seq
MIRT2167934	hsa-miR-519d	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT2167940	hsa-miR-520g	CLIP-seq
MIRT2167941	hsa-miR-520h	CLIP-seq
MIRT2470446	hsa-miR-548aa	CLIP-seq
MIRT2470447	hsa-miR-552	CLIP-seq
MIRT2470448	hsa-miR-570	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq
MIRT2167942	hsa-miR-93	CLIP-seq
MIRT2470437	hsa-miR-1294	CLIP-seq
MIRT2383956	hsa-miR-1827	CLIP-seq
MIRT2383957	hsa-miR-2682	CLIP-seq
MIRT2167926	hsa-miR-302a	CLIP-seq
MIRT2167927	hsa-miR-302b	CLIP-seq
MIRT2167928	hsa-miR-302c	CLIP-seq
MIRT2167929	hsa-miR-302d	CLIP-seq
MIRT2167930	hsa-miR-302e	CLIP-seq
MIRT2383958	hsa-miR-335	CLIP-seq
MIRT2167931	hsa-miR-372	CLIP-seq
MIRT2167932	hsa-miR-373	CLIP-seq
MIRT2470440	hsa-miR-3909	CLIP-seq
MIRT2470442	hsa-miR-4316	CLIP-seq
MIRT2383959	hsa-miR-449c	CLIP-seq
MIRT1927039	hsa-miR-4536	CLIP-seq
MIRT2383960	hsa-miR-455-3p	CLIP-seq
MIRT2383961	hsa-miR-4685-5p	CLIP-seq
MIRT769618	hsa-miR-4789-3p	CLIP-seq
MIRT2470444	hsa-miR-502-5p	CLIP-seq
MIRT2470445	hsa-miR-513b	CLIP-seq
MIRT2167935	hsa-miR-520a-3p	CLIP-seq
MIRT2167936	hsa-miR-520b	CLIP-seq
MIRT2167937	hsa-miR-520c-3p	CLIP-seq
MIRT2167938	hsa-miR-520d-3p	CLIP-seq
MIRT2167939	hsa-miR-520e	CLIP-seq
MIRT2470446	hsa-miR-548aa	CLIP-seq
MIRT2470448	hsa-miR-570	CLIP-seq
MIRT769625	hsa-miR-642b	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0002882	Process	Positive regulation of chronic inflammatory response to non-antigenic stimulus	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	29568380
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7558011
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	7558011
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	8022409
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IEA
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0016020	Component	Membrane	IEA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0042311	Process	Vasodilation	IBA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043306	Process	Positive regulation of mast cell degranulation	IEA
GO:0045202	Component	Synapse	IEA
GO:0060087	Process	Relaxation of vascular associated smooth muscle	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA

MIM	HGNC	e!Ensembl
600446	264	ENSG00000170425

P29275

Protein name

Adenosine receptor A2b

Protein function

Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

PDB

7XY6 , 7XY7 , 8HDO , 8HDP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	24 → 290	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL

Sequence length

332

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Calcium signaling pathway Neuroactive ligand-receptor interaction Vascular smooth muscle contraction Alcoholism		Adenosine P1 receptors G alpha (s) signalling events Surfactant metabolism ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	20619442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20619442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22679008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	22679008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26232643	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23483055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28971320, 35401817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28830843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	25629231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23584256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lung disease	Lung Diseases	BEFREE	29910735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	23855769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20619442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	25629231, 31263105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	23540714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	21270276, 23956030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	21270276, 23956030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23956030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32075205	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29935799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	35203352	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25629231	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	31263105		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	29651271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23956030, 30664911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16103269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23584256, 23855769, 25318478, 29910735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26228921	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28701304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	29910735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19253308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22038827, 23638125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	22038827	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	22038827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	26228921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31802389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	31036697		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31678144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36786018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23483055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31772626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	26228921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26228921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20619442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18351132		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25087184, 27479139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	26228921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31263105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	23540714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23483055, 30349649, 31846065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23956030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	31457100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	35562985, 37278400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	39639217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	29891411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33658578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25318478, 28701304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	27757725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26228921	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	40221657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31846065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36786018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	28548944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30349649		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADORA2B (adenosine A2b receptor)