Gene Gene information from NCBI Gene database.
Entrez ID 135935
Gene name NOBOX oogenesis homeobox
Gene symbol NOBOX
Synonyms (NCBI Gene)
OG-2OG2OG2XPOF5TCAG_12042
Chromosome 7
Chromosome location 7q35
Summary This homeobox gene encodes a transcription factor that is thought to play a role in oogenesis. In mice, it is essential for folliculogenesis and regulation of oocyte-specific genes. Defects in this gene result in premature ovarian failure type 5.[provided
SNPs SNP information provided by dbSNP.
7
SNP ID Visualize variation Clinical significance Consequence
rs7800847 G>A Benign-likely-benign, likely-benign, pathogenic, benign Coding sequence variant, missense variant
rs77587352 C>A Benign, pathogenic-likely-pathogenic Missense variant, coding sequence variant
rs193303102 G>A Pathogenic Coding sequence variant, stop gained
rs193303103 C>G Pathogenic Missense variant, coding sequence variant, intron variant
rs193303104 C>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
1
miRTarBase ID miRNA Experiments Reference
MIRT018764 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610934 22448 ENSG00000106410
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60393
Protein name Homeobox protein NOBOX
Protein function Transcription factor which may play a role in oogenesis. Binds preferentially to the DNA sequences 5'-TAATTG-3', 5'-TAGTTG-3' and 5'-TAATTA-3'.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 273 318 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in ovaries, testes and pancreas. Expressed within all stages of the adult female germline, from primordial follicles through to MII oocytes. {ECO:0000269|PubMed:16597639}.
Sequence
MALLLTLTSPDLEGTWDTRDKDGFKAQEGPPLAVPEFPVCGLYRIYGVCGSFSSFFIIRC
SLCALETLKSPQHDPLEIPEQSLKLIPLVSGKRELTRGQKAGEKPLAAGPGEEELLRGSA
PHAQDTQSEELPPSCTISGEKKPPAVSGEATGADAGRLCPPPRSRAPHKDRTLARSRPQT
QGEDCSLPVGEVKIGKRSYSPAPGKQKKPNAMGLAPTSSPGAPNSARATHNPVPCGSGRG
PCHLANLLSTLAQSNQNRDHKQGPPEVTCQIRKKTRTLYRSDQLEELEKIFQEDHYPDSD
KRREIAQTVGVTPQRIMV
KGAGSLVAGWSGGGPTIETLELQSERSAVAWVWFQNRRAKWR
KMEKLNGKESKDNPAAPGPASSQCSSAAEILPAVPMEPKPDPFPQESPLDTFPEPPMLLT
SDQTLAPTQPSEGAQRVVTPPLFSPPPVRRADLPFPLGPVHTPQLMPLLMDVAGSDSSHK
DGPCGSWGTSITLPPPCSYLEELEPQDYQQSNQPGPFQFSQAPQPPLFQSPQPKLPYLPT
FPFSMPSSLTLPPPEDSLFMFPCGPSGGTSQGYCPGASSGQILMQPPAGNIGTASWSDPC
LPELPFPGPFCPQALGHPPGGDGYFPDLFPTPCPQALGRQPSSALSWMPEGARPGTGPLL
SKAKEEPPAASLDQPSALEEARGDDKNSHVP
Sequence length 691
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Genetic non-acquired premature ovarian failure Pathogenic; Likely pathogenic rs1353957108, rs1476085935, rs2128861344, rs568492478, rs2128860927 RCV001661754
RCV001661773
RCV001663369
RCV001663374
RCV001663375
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
NOBOX-related disorder Likely pathogenic rs991077121 RCV003402254
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Premature ovarian failure Likely pathogenic rs1006463439 RCV001270206
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Premature ovarian failure 5 Pathogenic; Likely pathogenic rs193303102, rs193303103, rs193303104, rs1218620893 RCV000154189
RCV000154192
RCV000154193
RCV001002729
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Familial cancer of breast Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Premature ovarian failure 1 Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amenorrhea Amenorrhea Pubtator 34480423 Associate
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 18675947
★☆☆☆☆
Found in Text Mining only
Familial Testotoxicosis Testotoxicosis BEFREE 20593028
★☆☆☆☆
Found in Text Mining only
Gonadal Dysgenesis Gonadal dysgenesis Pubtator 33101191 Associate
★☆☆☆☆
Found in Text Mining only
NON RARE IN EUROPE: Primary ovarian failure Ovarian Failure Orphanet
★☆☆☆☆
Found in Text Mining only
Ovarian Dysgenesis 2 Ovarian dysgenesis Pubtator 17701902, 18930203 Associate
★☆☆☆☆
Found in Text Mining only
Ovarian Failure, Premature Ovarian Failure BEFREE 15950662, 17701902, 18675947, 18689850, 25514101, 26848058, 27798098, 27836978, 28743298, 29067606
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ovarian Failure, Premature Ovarian Failure LHGDN 15950662, 17701902
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Ovarian Failure, Premature Ovarian Failure GENOMICS_ENGLAND_DG 25514101
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Premature Menopause Premature Menopause BEFREE 15950662, 17701902, 18675947, 18689850, 25514101, 26848058, 27798098, 28743298
★☆☆☆☆
Found in Text Mining only