CPA3 (carboxypeptidase A3)

Gene

• Entrez ID: 1359
• Gene name: Carboxypeptidase A3
• Gene symbol: CPA3
• Synonyms (NCBI Gene): MC-CPA
• Chromosome: 3
• Chromosome location: 3q24
• Summary: This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. The encoded preproprotein is proteolytically processed to generate a mature protease that is released by mast cells and may be involved in the degradation of endogenous

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019464	hsa-miR-148b-3p	Microarray	17612493
MIRT023344	hsa-miR-122-5p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002002	Process	Regulation of angiotensin levels in blood	IEA
GO:0002003	Process	Angiotensin maturation	IEA
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IBA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	NAS	2594780
GO:0004181	Function	Metallocarboxypeptidase activity	TAS	1629626
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	TAS	2708524
GO:0008233	Function	Peptidase activity	IEA
GO:0008237	Function	Metallopeptidase activity	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030133	Component	Transport vesicle	IEA
GO:0030141	Component	Secretory granule	NAS	2594780
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 114851
• HGNC: 2298
• e!Ensembl: ENSG00000163751

Protein

• UniProt ID: P15088
• Protein name: Mast cell carboxypeptidase A (MC-CPA) (EC 3.4.17.1) (Carboxypeptidase A3)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02244	Propep_M14	27 → 103	Carboxypeptidase activation peptide	Domain
  PF00246	Peptidase_M14	125 → 404	Zinc carboxypeptidase	Domain

• Sequence:

  MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
  AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
  NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
  VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
  QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
  ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
  SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS

• Sequence length: 417

Pathways

KEGG:

Renin-angiotensin system
Pancreatic secretion
Protein digestion and absorption

Reactome:

Metabolism of Angiotensinogen to Angiotensins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations