PACRG (parkin coregulated)

Gene

• Entrez ID: 135138
• Gene name: Parkin coregulated
• Gene symbol: PACRG
• Synonyms (NCBI Gene): BUG21, GLUP, HAK005771, PACRG2.1, PARK2CRG, pf12
• Chromosome: 6
• Chromosome location: 6q26
• Summary: This gene encodes a protein that is conserved across metazoans. In vertebrates, this gene is linked in a head-to-head arrangement with the adjacent parkin gene, which is associated with autosomal recessive juvenile Parkinson`s disease. These genes are co-

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029821	hsa-miR-26b-5p	Microarray	19088304
MIRT734318	hsa-miR-5571-3p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT734319	hsa-miR-146b-3p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT734320	hsa-miR-21-5p	Immunofluorescence, qRT-PCR, RNA-seq, Western blotting	31735554
MIRT2060139	hsa-miR-1245b-3p	CLIP-seq
MIRT2060139	hsa-miR-1245b-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001664	Function	G protein-coupled receptor binding	IPI	14532270
GO:0002177	Component	Manchette	IEA
GO:0003779	Function	Actin binding	IDA	14532270
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	14532270
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005879	Component	Axonemal microtubule	IDA	36191189
GO:0005879	Component	Axonemal microtubule	ISS
GO:0005929	Component	Cilium	IEA
GO:0007286	Process	Spermatid development	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0030317	Process	Flagellated sperm motility	IEA
GO:0030544	Function	Hsp70 protein binding	IBA
GO:0030544	Function	Hsp70 protein binding	IDA	14532270
GO:0031072	Function	Heat shock protein binding	IPI	14532270
GO:0031514	Component	Motile cilium	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14532270
GO:0031982	Component	Vesicle	IBA
GO:0031982	Component	Vesicle	IDA	14532270
GO:0031982	Component	Vesicle	IEA
GO:0034620	Process	Cellular response to unfolded protein	TAS	14532270
GO:0036126	Component	Sperm flagellum	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IDA	14532270
GO:0043005	Component	Neuron projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IDA	14532270
GO:0044297	Component	Cell body	IEA
GO:0048487	Function	Beta-tubulin binding	IDA	14532270
GO:0051087	Function	Protein-folding chaperone binding	IPI	14532270
GO:0051879	Function	Hsp90 protein binding	IBA
GO:0051879	Function	Hsp90 protein binding	IDA	14532270
GO:0097225	Component	Sperm midpiece	IEA
GO:0097386	Component	Glial cell projection	IEA
GO:0160112	Component	Axonemal B tubule inner sheath	IEA

Other IDs

• MIM: 608427
• HGNC: 19152
• e!Ensembl: ENSG00000112530

Protein

• UniProt ID: Q96M98
• Protein name: Parkin coregulated gene protein (Molecular chaperone/chaperonin-binding protein) (PARK2 coregulated gene protein)
• Protein function: Microtubule inner protein (MIP) part of the dynein-decorated doublet microtubules (DMTs) in cilia axoneme, which is required for motile cilia beating (PubMed:36191189). Suppresses cell death induced by accumulation of unfolded Pael receptor (Pae
• PDB: 6NDU, 6NEP, 6UCC, 7UNG, 8J07
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10274	ParcG	70 → 218	Parkin co-regulated protein	Family
  PF10274	ParcG	233 → 292	Parkin co-regulated protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in all immune tissues, spleen, lymph nodes, thymus, tonsils, leukocyte and bone marrow. Expressed also in heart, brain, skeletal muscle, kidney, lung and pancreas. Expressed in primary Schwann cells and very weakly by monocyt
• Sequence:

  MVAEKETLSLNKCPDKMPKRTKLLAQQPLPVHQPHSLVSEGFTVKAMMKNSVVRGPPAAG
  AFKERPTKPTAFRKFYERGDFPIALEHDSKGNKIAWKVEIEKLDYHHYLPLFFDGLCEMT
  FPYEFFARQGIHDMLEHGGNKILPVLPQLIIPIKNALNLRNRQVICVTLKVLQHLVVSAE
  MVGKALVPYYRQILPVLNIFKNMNGSYSLPRLECSGAIMARCNLDHLGSSDPPTSASQVA
  EIIVNSGDGIDYSQQKRENIGDLIQETLEAFERYGGENAFINIKYVVPTYESCLLN

• Sequence length: 296

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSTRUCTIVE SLEEP APNEA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPOTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG ONSET PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	16287063		★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	19268936	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	16287063		★☆☆☆☆ Found in Text Mining only
Buruli Ulcer	Buruli ulcer	Pubtator	27128681	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18592004	Inhibit	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18592004, 23125027		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16582634	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16287063		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	LHGDN	16287063		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	14737177, 15653309, 16391553, 16734611, 21816242, 23052943, 23861666		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	16734611, 23861666, 32433683	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	16287063		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23733339	Associate	★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	14532270	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16287063		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32271791	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16287063, 23125027		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	15964273		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16287063		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27286703	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	14532270, 17590346		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	14532270	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14737177		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	17068781		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	16287063		★☆☆☆☆ Found in Text Mining only