ADORA2A (adenosine A2a receptor)

Gene

• Entrez ID: 135
• Gene name: Adenosine A2a receptor
• Gene symbol: ADORA2A
• Synonyms (NCBI Gene): A2aR, ADORA2, RDC8
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT735114	hsa-miR-885-3p	qRT-PCR	31776299
MIRT769588	hsa-miR-1291	CLIP-seq
MIRT769589	hsa-miR-296-5p	CLIP-seq
MIRT769590	hsa-miR-3173-5p	CLIP-seq
MIRT769591	hsa-miR-4446-3p	CLIP-seq
MIRT769592	hsa-miR-4492	CLIP-seq
MIRT769593	hsa-miR-4498	CLIP-seq
MIRT769594	hsa-miR-4505	CLIP-seq
MIRT769595	hsa-miR-4721	CLIP-seq
MIRT769596	hsa-miR-545	CLIP-seq
MIRT769597	hsa-miR-762	CLIP-seq
MIRT1927034	hsa-miR-2115	CLIP-seq
MIRT1927035	hsa-miR-3180-5p	CLIP-seq
MIRT1927036	hsa-miR-516a-3p	CLIP-seq
MIRT1927037	hsa-miR-520a-5p	CLIP-seq
MIRT1927038	hsa-miR-525-5p	CLIP-seq
MIRT2167913	hsa-miR-1184	CLIP-seq
MIRT2167914	hsa-miR-1205	CLIP-seq
MIRT2167915	hsa-miR-1273f	CLIP-seq
MIRT769588	hsa-miR-1291	CLIP-seq
MIRT769589	hsa-miR-296-5p	CLIP-seq
MIRT2167916	hsa-miR-3145-5p	CLIP-seq
MIRT2167917	hsa-miR-3158-5p	CLIP-seq
MIRT769590	hsa-miR-3173-5p	CLIP-seq
MIRT769591	hsa-miR-4446-3p	CLIP-seq
MIRT769592	hsa-miR-4492	CLIP-seq
MIRT769593	hsa-miR-4498	CLIP-seq
MIRT769594	hsa-miR-4505	CLIP-seq
MIRT769595	hsa-miR-4721	CLIP-seq
MIRT2167918	hsa-miR-483-3p	CLIP-seq
MIRT2167919	hsa-miR-544	CLIP-seq
MIRT2167920	hsa-miR-668	CLIP-seq
MIRT769597	hsa-miR-762	CLIP-seq
MIRT2383950	hsa-miR-138	CLIP-seq
MIRT2383951	hsa-miR-3907	CLIP-seq
MIRT2383952	hsa-miR-4530	CLIP-seq
MIRT2383953	hsa-miR-4693-3p	CLIP-seq
MIRT2383954	hsa-miR-548q	CLIP-seq
MIRT2383955	hsa-miR-663b	CLIP-seq
MIRT2674618	hsa-miR-1182	CLIP-seq
MIRT2674619	hsa-miR-1266	CLIP-seq
MIRT2674620	hsa-miR-1976	CLIP-seq
MIRT2674621	hsa-miR-4290	CLIP-seq
MIRT2674622	hsa-miR-4518	CLIP-seq
MIRT2674623	hsa-miR-4639-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Unknown	17082635
RELA	Unknown	17082635
YY1	Unknown	20666933
ZNF148	Unknown	20666933

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IDA	21393508, 21593763
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IBA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IBA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	11571652, 12189203, 16027149, 16339847, 16481441, 17356572, 17689978, 19694902, 23296780, 28102227, 28298427, 28734904, 29568380, 31286866, 32296183
GO:0005516	Function	Calmodulin binding	EXP	25692595
GO:0005516	Function	Calmodulin binding	IDA	25692595
GO:0005516	Function	Calmodulin binding	IMP	25692595
GO:0005882	Component	Intermediate filament	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25644539
GO:0005886	Component	Plasma membrane	IDA	16339847
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	21393508
GO:0005886	Component	Plasma membrane	TAS	8794889
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006909	Process	Phagocytosis	TAS	8360491
GO:0006915	Process	Apoptotic process	TAS	7818494
GO:0006954	Process	Inflammatory response	TAS	8360491
GO:0006968	Process	Cellular defense response	TAS	10051547
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	10899090
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	21393508
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	7818494
GO:0007271	Process	Synaptic transmission, cholinergic	IEA
GO:0007417	Process	Central nervous system development	TAS	10945659
GO:0007596	Process	Blood coagulation	TAS	10899090
GO:0007600	Process	Sensory perception	TAS	9262401
GO:0007626	Process	Locomotory behavior	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008015	Process	Blood circulation	TAS	9262401
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008289	Function	Lipid binding	IPI	25692595
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0014049	Process	Positive regulation of glutamate secretion	IEA
GO:0014057	Process	Positive regulation of acetylcholine secretion, neurotransmission	IEA
GO:0014061	Process	Regulation of norepinephrine secretion	IEA
GO:0014074	Process	Response to purine-containing compound	IDA	25644539
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10051547
GO:0019899	Function	Enzyme binding	IPI	16339847
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030673	Component	Axolemma	IEA
GO:0031000	Process	Response to caffeine	IEA
GO:0031802	Function	Type 5 metabotropic glutamate receptor binding	IEA
GO:0032230	Process	Positive regulation of synaptic transmission, GABAergic	IEA
GO:0032279	Component	Asymmetric synapse	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0035810	Process	Positive regulation of urine volume	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0042802	Function	Identical protein binding	IPI	18675812, 19013155, 29568380
GO:0043025	Component	Neuronal cell body	IEA
GO:0043116	Process	Negative regulation of vascular permeability	IEA
GO:0043279	Process	Response to alkaloid	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045938	Process	Positive regulation of circadian sleep/wake cycle, sleep	IEA
GO:0046636	Process	Negative regulation of alpha-beta T cell activation	IEA
GO:0048143	Process	Astrocyte activation	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0050714	Process	Positive regulation of protein secretion	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0051393	Function	Alpha-actinin binding	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0051899	Process	Membrane depolarization	IEA
GO:0051924	Process	Regulation of calcium ion transport	IEA
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060080	Process	Inhibitory postsynaptic potential	IEA
GO:0060134	Process	Prepulse inhibition	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0097190	Process	Apoptotic signaling pathway	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099171	Process	Presynaptic modulation of chemical synaptic transmission	IEA
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 102776
• HGNC: 263
• e!Ensembl: ENSG00000128271

Protein

• UniProt ID: P29274
• Protein name: Adenosine receptor A2a
• Protein function: Receptor for adenosine (By similarity). The activity of this receptor is mediated by G proteins which activate adenylyl cyclase (By similarity).
• PDB: 2YDO, 2YDV, 3EML, 3PWH, 3QAK, 3REY, 3RFM, 3UZA, 3UZC, 3VG9, 3VGA, 4EIY, 4UG2, 4UHR, 5G53, 5IU4, 5IU7, 5IU8, 5IUA, 5IUB, 5JTB, 5K2A, 5K2B, 5K2C, 5K2D, 5MZJ, 5MZP, 5N2R, 5NLX, 5NM2, 5NM4, 5OLG, 5OLH, 5OLO, 5OLV, 5OLZ, 5OM1, 5OM4, 5UIG, 5UVI, 5VRA, 5WF5, 5WF6, 6AQF, 6GDG, 6GT3, 6JZH, 6LPJ, 6LPK, 6LPL, 6MH8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	23 → 288	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
  PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
  AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
  NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
  LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
  KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
  YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

• Sequence length: 412

Pathways

KEGG:

Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Parkinson disease
Alcoholism

Reactome:

Adenosine P1 receptors
G alpha (s) signalling events
Surfactant metabolism
ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute encephalopathy with biphasic seizures and late reduced diffusion	Encephalopathy With Biphasic Seizures And Diffusion	BEFREE	23535492, 25156649		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy with biphasic seizures and late reduced diffusion	Encephalopathy With Biphasic Seizures And Diffusion	ORPHANET_DG	23535492		★☆☆☆☆ Found in Text Mining only
Acute encephalopathy with biphasic seizures and late reduced diffusion	Encephalopathy With Biphasic Seizures And Diffusion	Orphanet			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23917542		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	14666117, 15774265		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	24321892, 28941407, 32289327, 33275249, 36006974, 36430879	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	23377438, 30185656	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	30511252	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	16118787, 18305461, 19565319, 20334879, 20520601, 22940476, 30248915		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	16221767, 18305461, 20520601, 22012471, 24943643, 33235193	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	12825092, 16118787, 18305461, 20532872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	BEFREE	16118787, 18305461, 19565319, 20334879, 20520601, 22940476, 27262510, 30248915, 30946941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	22012471, 26317759, 33235193	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	12825092, 16118787, 18305461, 20532872		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	23377438	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30516351		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	22923002, 27770044, 31140226, 35023427	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	16339780, 18442791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26232643	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	37047660	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33801676, 36901835	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	23332182, 26317759, 33373678	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23332182, 30946941		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	19565319		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28421534, 28438638, 28668513, 28807491		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	10962152	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25341542		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	30594050	Associate	★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	23535492	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35627170	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35485681	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31732494, 33416945	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	20363887		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	31444994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	20363887		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	33373678	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23341106		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27061011	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18205922	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30931525		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	25629231		★☆☆☆☆ Found in Text Mining only
Chronic Insomnia	Insomnia	CTD_human_DG	20532872		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	16339780		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17804147		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	38201235	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	33820558	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	27476546, 30513523	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32468013	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31275983, 37945707	Associate	★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	18305461	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23341106, 25629231		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26654777		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26654777		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31444994	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33342966	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	38201235	Associate	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	24321892	Inhibit	★☆☆☆☆ Found in Text Mining only
Dementia Vascular	Vascular dementia	Pubtator	24321892	Associate	★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	24321892		★☆☆☆☆ Found in Text Mining only
Depression, Neurotic	Mental Depression	CTD_human_DG	26860412		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26317759, 30511252	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	26860412		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29277734, 29761007, 30511252		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Syndrome	Mental Depression	CTD_human_DG	26860412		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	26654777, 30886019		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26654777, 30886019		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21088442	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	26654777		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	20182024, 25872644, 29375464		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	32075205	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	28668513		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	31353670	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	23535492		★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	26860412		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27038930		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15257174, 9880133		★☆☆☆☆ Found in Text Mining only
Etat Marbre	Status marmoratus	CTD_human_DG	26526685		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17872970		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	18539621	Associate	★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	26317759		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27038930		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37047660	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23341106		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	25629231	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	27399166		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16184606, 19591938, 20512606, 23385980		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	16184606		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	18536175	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	31444994	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29677206, 9262401		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	31324842	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27061011	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36445478	Stimulate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30516351		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30886019		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19253308	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30513523		★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
Lesch-Nyhan Syndrome	Lesch-Nyhan Syndrome	BEFREE	22403020		★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	27399166		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24682220	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31930120	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31732494		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31339445		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23917542		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	26860412		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25341542, 25377469		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35247927, 35563024	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29277734, 29761007, 30511252		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Migraine with Aura	Migraine with Aura	BEFREE	17257240		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	20413899, 28941407		★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	15774265		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16969271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16969271		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	30511252	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Movement Disorders	Movement Disorders	CTD_human_DG	26526685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	20363887		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	17616786, 33342966	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29396305		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	29396305	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	20484596		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	22740769, 31776299	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27038930, 28582704		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10617149	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	18536175	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24892887		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	28011152		★☆☆☆☆ Found in Text Mining only
Nonorganic Insomnia	Nonorganic Insomnia	CTD_human_DG	20532872		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30886019		★☆☆☆☆ Found in Text Mining only
Osteogenesis imperfecta type 2A	Osteogenesis imperfecta	Pubtator	20002525	Associate	★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	CTD_human_DG	12825092		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	15774265		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	CTD_human_DG	12825092		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	BEFREE	14666117, 15774265, 19565319, 20334879, 22940476, 23018769, 26589317		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	LHGDN	14666117, 15774265		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic disorder	Pubtator	23018769	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	10962152, 18536175, 21281405, 28135712, 31353670, 35532631, 36006974, 36010675, 38027039	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	14663020, 15719154, 17804147, 20182024, 21281405, 24892887, 25872644, 25936513, 28067172, 28093976, 28135712, 28870576, 29672326, 30689733, 30987056, 31354407, 31469906		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	27195966		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	19565319		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	20334879		★☆☆☆☆ Found in Text Mining only
Primary Insomnia	Insomnia	CTD_human_DG	20532872		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30179225	Associate	★☆☆☆☆ Found in Text Mining only
Psychophysiological Insomnia	Psychophysiological Insomnia	CTD_human_DG	20532872		★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	31353670		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31732494		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28928465		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa Concentric	Retinitis pigmentosa	Pubtator	30511252	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	19192274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	19902562, 31140226		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	15719154, 22705363, 24169640, 24433848, 31695381, 9029412, 9050917		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15719154, 20691427, 22705363, 24433848		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	22705363	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	38201235	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	23663495	Associate	★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	23535492	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	CTD_human_DG	27757725		★☆☆☆☆ Found in Text Mining only
Severe combined immunodeficiency due to adenosine deaminase deficiency	Severe combined immunodeficiency	Pubtator	37047660	Associate	★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	22740769		★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	33920292	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Initiation and Maintenance Disorders	Sleep Disorders	CTD_human_DG	20532872		★☆☆☆☆ Found in Text Mining only
Sleep Initiation Dysfunction	Sleep Disorders	CTD_human_DG	20532872		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29692361	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	28592285, 30221045		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	23535492		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status epilepticus	Pubtator	23535492	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31339445		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31339445, 31930120	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	34311536	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	30956681		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	21658325		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	25450226		★☆☆☆☆ Found in Text Mining only
Thromboembolic stroke	Thromboembolic stroke	BEFREE	30931525		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26317759	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27476546, 30513523		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	CTD_human_DG	26860412		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	23018769	Associate	★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	19488739		★☆☆☆☆ Found in Text Mining only