Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	134728
Gene name	Interleukin 1 receptor associated kinase 1 binding protein 1
Gene symbol	IRAK1BP1
Synonyms (NCBI Gene)	AIP70SIMPL
Chromosome	6
Chromosome location	6q14.1

103

Show/Hide all (103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT689153	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT689152	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT689151	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689150	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT689149	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT689148	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT689147	hsa-miR-1285-3p	HITS-CLIP	23313552
MIRT689146	hsa-miR-3187-5p	HITS-CLIP	23313552
MIRT689145	hsa-miR-5189-5p	HITS-CLIP	23313552
MIRT689144	hsa-miR-612	HITS-CLIP	23313552
MIRT689143	hsa-miR-6860	HITS-CLIP	23313552
MIRT689142	hsa-miR-4537	HITS-CLIP	23313552
MIRT689141	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT689140	hsa-miR-6086	HITS-CLIP	23313552
MIRT689139	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT689138	hsa-miR-661	HITS-CLIP	23313552
MIRT689137	hsa-miR-658	HITS-CLIP	23313552
MIRT689136	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT689135	hsa-miR-25-5p	HITS-CLIP	23313552
MIRT689134	hsa-miR-7703	HITS-CLIP	23313552
MIRT689133	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT689132	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT568682	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT568681	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT568680	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT568679	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT568678	hsa-miR-4262	PAR-CLIP	20371350
MIRT568677	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568676	hsa-miR-759	PAR-CLIP	20371350
MIRT568682	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT568681	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT568680	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT568679	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT568678	hsa-miR-4262	PAR-CLIP	20371350
MIRT568677	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568676	hsa-miR-759	PAR-CLIP	20371350
MIRT727426	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT727425	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT727424	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT727423	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT689147	hsa-miR-1285-3p	PAR-CLIP	27292025
MIRT568682	hsa-miR-181a-5p	PAR-CLIP	27292025
MIRT568681	hsa-miR-181b-5p	PAR-CLIP	27292025
MIRT568680	hsa-miR-181c-5p	PAR-CLIP	27292025
MIRT568679	hsa-miR-181d-5p	PAR-CLIP	27292025
MIRT689136	hsa-miR-196a-3p	PAR-CLIP	27292025
MIRT689146	hsa-miR-3187-5p	PAR-CLIP	27292025
MIRT568678	hsa-miR-4262	PAR-CLIP	27292025
MIRT689142	hsa-miR-4537	PAR-CLIP	27292025
MIRT689133	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT689153	hsa-miR-508-5p	PAR-CLIP	27292025
MIRT689145	hsa-miR-5189-5p	PAR-CLIP	27292025
MIRT689144	hsa-miR-612	PAR-CLIP	27292025
MIRT689139	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT689132	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT689138	hsa-miR-661	PAR-CLIP	27292025
MIRT689151	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT689143	hsa-miR-6860	PAR-CLIP	27292025
MIRT568676	hsa-miR-759	PAR-CLIP	27292025
MIRT689149	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT568677	hsa-miR-892c-5p	PAR-CLIP	27292025
MIRT689150	hsa-miR-939-3p	PAR-CLIP	27292025
MIRT689153	hsa-miR-508-5p	HITS-CLIP	23313552
MIRT689152	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT689151	hsa-miR-6849-3p	HITS-CLIP	23313552
MIRT689150	hsa-miR-939-3p	HITS-CLIP	23313552
MIRT689149	hsa-miR-766-3p	HITS-CLIP	23313552
MIRT689148	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT689147	hsa-miR-1285-3p	HITS-CLIP	23313552
MIRT689146	hsa-miR-3187-5p	HITS-CLIP	23313552
MIRT689145	hsa-miR-5189-5p	HITS-CLIP	23313552
MIRT689144	hsa-miR-612	HITS-CLIP	23313552
MIRT689143	hsa-miR-6860	HITS-CLIP	23313552
MIRT689142	hsa-miR-4537	HITS-CLIP	23313552
MIRT689141	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT689140	hsa-miR-6086	HITS-CLIP	23313552
MIRT689139	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT689138	hsa-miR-661	HITS-CLIP	23313552
MIRT689137	hsa-miR-658	HITS-CLIP	23313552
MIRT689136	hsa-miR-196a-3p	HITS-CLIP	23313552
MIRT689135	hsa-miR-25-5p	HITS-CLIP	23313552
MIRT689134	hsa-miR-7703	HITS-CLIP	23313552
MIRT689133	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT689132	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT568682	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT568681	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT568680	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT568679	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT568678	hsa-miR-4262	PAR-CLIP	20371350
MIRT568677	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568676	hsa-miR-759	PAR-CLIP	20371350
MIRT568682	hsa-miR-181a-5p	PAR-CLIP	20371350
MIRT568681	hsa-miR-181b-5p	PAR-CLIP	20371350
MIRT568680	hsa-miR-181c-5p	PAR-CLIP	20371350
MIRT568679	hsa-miR-181d-5p	PAR-CLIP	20371350
MIRT568678	hsa-miR-4262	PAR-CLIP	20371350
MIRT568677	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT568676	hsa-miR-759	PAR-CLIP	20371350
MIRT1070419	hsa-miR-3121-3p	CLIP-seq
MIRT1070420	hsa-miR-3609	CLIP-seq
MIRT1070421	hsa-miR-4803	CLIP-seq
MIRT1070422	hsa-miR-548ah	CLIP-seq
MIRT1070423	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006955	Process	Immune response	IEA
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS

MIM	HGNC	e!Ensembl
615375	17368	ENSG00000146243

Q5VVH5

Protein name

Interleukin-1 receptor-associated kinase 1-binding protein 1 (IRAK1-binding protein 1)

Protein function

Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04402	SIMPL	53 → 253	Protein of unknown function (DUF541)	Family

Sequence

MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSE
VSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVEN
AYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVE
NAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHA
ASKVFITFEVKGKEKRKKHL

Sequence length

260

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN PROSTATIC HYPERPLASIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL POLYP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE REPRODUCTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SICCA SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN'S SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGRENS SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abnormal fear/anxiety-related behavior	Behavioral abnormality	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	17079333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
DEVELOPMENTAL DELAY, INTELLECTUAL DISABILITY, OBESITY, AND DYSMORPHIC FEATURES	Developmental Delay, Intellectual Disability, Obesity, And Dysmorphic Features	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17079333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24165912	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild Mental Retardation	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24097067	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sjogren`s Syndrome	Sjogren`s Syndrome	CTD_human_DG	24097067		★★★★★ ★☆☆☆☆ Found in Text Mining only

IRAK1BP1 (interleukin 1 receptor associated kinase 1 binding protein 1)