Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	134526
Gene name	Acyl-CoA thioesterase 12
Gene symbol	ACOT12
Synonyms (NCBI Gene)	CACH-1CachSTARD15THEAL
Chromosome	5
Chromosome location	5q14.1

Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025162	hsa-miR-181a-5p	Microarray	17612493
MIRT045136	hsa-miR-186-5p	CLASH	23622248
MIRT762872	hsa-miR-1245b-3p	CLIP-seq
MIRT762873	hsa-miR-1827	CLIP-seq
MIRT762874	hsa-miR-3127-5p	CLIP-seq
MIRT762875	hsa-miR-3918	CLIP-seq
MIRT762876	hsa-miR-636	CLIP-seq
MIRT762877	hsa-miR-7	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003986	Function	Acetyl-CoA hydrolase activity	IBA
GO:0003986	Function	Acetyl-CoA hydrolase activity	IEA
GO:0003986	Function	Acetyl-CoA hydrolase activity	ISS
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006084	Process	Acetyl-CoA metabolic process	IBA
GO:0006084	Process	Acetyl-CoA metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006637	Process	Acyl-CoA metabolic process	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016790	Function	Thiolester hydrolase activity	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0045171	Component	Intercellular bridge	IDA
GO:0052689	Function	Carboxylic ester hydrolase activity	IEA

MIM	HGNC	e!Ensembl
614315	24436	ENSG00000172497

Q8WYK0

Protein name

Acetyl-coenzyme A thioesterase (EC 3.1.2.1) (Acyl-CoA thioester hydrolase 12) (Acyl-coenzyme A thioesterase 12) (Acyl-CoA thioesterase 12) (Cytoplasmic acetyl-CoA hydrolase 1) (CACH-1) (hCACH-1) (START domain-containing protein 15) (StARD15)

Protein function

Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels (PubMed:16951743). Preferentially hydrolyzes acetyl-CoA (PubMed:16951743).

PDB

3B7K , 4MOB , 4MOC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03061	4HBT	24 → 100	Thioesterase superfamily	Domain
PF03061	4HBT	197 → 274	Thioesterase superfamily	Domain
PF01852	START	349 → 515	START domain	Domain

Sequence

MERPAPGEVVMSQAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQ
FEETARVGQVITIKAKVTRAFSTSMEISIKVMVQDMLTGIEKLVSVAFSTFVAKPVGKEK
IHLKPVTLLTEQDHVEHNLAAERRKVRLQHEDTFNNLMKESSKFDDLIFDEEEGAVSTRG
TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPST
VGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITF
PRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALK
KLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHF
VSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVP
PSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCI
QFLENPPDDGFVSTF

Sequence length

555

Interactions

View interactions

	KEGG		Reactome
	Pyruvate metabolism Metabolic pathways		Mitochondrial Fatty Acid Beta-Oxidation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	12325082, 20016818, 20958979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35986010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	BEFREE	20016818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30661930, 9232351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9232351		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACOT12 (acyl-CoA thioesterase 12)