Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1345
Gene name	Cytochrome c oxidase subunit 6C
Gene symbol	COX6C
Synonyms (NCBI Gene)	-
Chromosome	8
Chromosome location	8q22.2
Summary	Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multip

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments
MIRT905493	hsa-miR-2053	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT905508	hsa-miR-569	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT905494	hsa-miR-3125	CLIP-seq
MIRT905496	hsa-miR-335	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905498	hsa-miR-3916	CLIP-seq
MIRT905499	hsa-miR-3928	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905497	hsa-miR-3607-5p	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT905501	hsa-miR-4276	CLIP-seq
MIRT905502	hsa-miR-4504	CLIP-seq
MIRT905503	hsa-miR-4697-3p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905505	hsa-miR-4731-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT905507	hsa-miR-4801	CLIP-seq
MIRT905509	hsa-miR-592	CLIP-seq
MIRT905510	hsa-miR-597	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905511	hsa-miR-664	CLIP-seq
MIRT905512	hsa-miR-873	CLIP-seq
MIRT905493	hsa-miR-2053	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT2507897	hsa-miR-539	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT2507898	hsa-miR-548u	CLIP-seq
MIRT905508	hsa-miR-569	CLIP-seq
MIRT905495	hsa-miR-3185	CLIP-seq
MIRT1968511	hsa-miR-3973	CLIP-seq
MIRT905500	hsa-miR-4272	CLIP-seq
MIRT1968512	hsa-miR-4693-5p	CLIP-seq
MIRT905504	hsa-miR-4714-3p	CLIP-seq
MIRT905506	hsa-miR-4760-3p	CLIP-seq
MIRT2507897	hsa-miR-539	CLIP-seq
MIRT1968513	hsa-miR-548l	CLIP-seq
MIRT2507898	hsa-miR-548u	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	17500595, 32296183, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005758	Component	Mitochondrial intermembrane space	TAS
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	2849755
GO:0006119	Process	Oxidative phosphorylation	IEA
GO:0006123	Process	Mitochondrial electron transport, cytochrome c to oxygen	NAS	30030519
GO:0016020	Component	Membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IDA	30030519
GO:0045277	Component	Respiratory chain complex IV	IEA
GO:0045333	Process	Cellular respiration	NAS	30030519

MIM	HGNC	e!Ensembl
124090	2285	ENSG00000164919

P09669

Protein name

Cytochrome c oxidase subunit 6C (Cytochrome c oxidase polypeptide VIc)

Protein function

Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiqu

PDB

5Z62

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02937	COX6C	5 → 74	Cytochrome c oxidase subunit VIc	Family

Sequence

MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Oxidative phosphorylation Metabolic pathways Cardiac muscle contraction Thermogenesis Non-alcoholic fatty liver disease Alzheimer disease Parkinson disease Amyotrophic lateral sclerosis Huntington disease Prion disease Pathways of neurodegeneration - multiple diseases Chemical carcinogenesis - reactive oxygen species Diabetic cardiomyopathy		TP53 Regulates Metabolic Genes Respiratory electron transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	31497264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33318294	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36594618, 37510369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	38242874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cohen syndrome	Cohen Syndrome	CLINVAR_DG	15141358, 19006247, 20461111, 27533158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33083497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	38196829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	36451838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31497264		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31497264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34714849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	38242874	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34623759, 36551283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11943344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	24204994	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37482618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	10679920		★★★★★ ★☆☆☆☆ Found in Text Mining only

COX6C (cytochrome c oxidase subunit 6C)