Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	134353
Gene name	LSM11, U7 small nuclear RNA associated
Gene symbol	LSM11
Synonyms (NCBI Gene)	AGS8
Chromosome	5
Chromosome location	5q33.3

195

Show/Hide all (195)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044861	hsa-miR-195-5p	CLASH	23622248
MIRT571931	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT571930	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT571928	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT571929	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT044861	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT571927	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT571926	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT571924	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT571925	hsa-miR-548p	PAR-CLIP	20371350
MIRT571923	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT571922	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT571921	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT571920	hsa-miR-6081	PAR-CLIP	20371350
MIRT522706	hsa-miR-4438	PAR-CLIP	23446348
MIRT522705	hsa-miR-3064-5p	PAR-CLIP	23446348
MIRT522704	hsa-miR-6504-5p	PAR-CLIP	23446348
MIRT522703	hsa-miR-5186	PAR-CLIP	23446348
MIRT522702	hsa-miR-1254	PAR-CLIP	23446348
MIRT522701	hsa-miR-3116	PAR-CLIP	23446348
MIRT522700	hsa-miR-661	PAR-CLIP	23446348
MIRT522699	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT522698	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT522697	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT522696	hsa-miR-5095	PAR-CLIP	23446348
MIRT522695	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT522694	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT571926	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT571931	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT571927	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT044861	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT571931	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT571930	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT571928	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT571929	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT044861	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT571927	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT571926	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT571924	hsa-miR-548at-5p	PAR-CLIP	20371350
MIRT571925	hsa-miR-548p	PAR-CLIP	20371350
MIRT571923	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT571922	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT571921	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT571920	hsa-miR-6081	PAR-CLIP	20371350
MIRT522706	hsa-miR-4438	PAR-CLIP	23446348
MIRT522705	hsa-miR-3064-5p	PAR-CLIP	23446348
MIRT522704	hsa-miR-6504-5p	PAR-CLIP	23446348
MIRT522703	hsa-miR-5186	PAR-CLIP	23446348
MIRT522702	hsa-miR-1254	PAR-CLIP	23446348
MIRT522701	hsa-miR-3116	PAR-CLIP	23446348
MIRT522700	hsa-miR-661	PAR-CLIP	23446348
MIRT522699	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT522698	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT522697	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT522696	hsa-miR-5095	PAR-CLIP	23446348
MIRT522695	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT522694	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT1121419	hsa-miR-1229	CLIP-seq
MIRT1121420	hsa-miR-1264	CLIP-seq
MIRT1121421	hsa-miR-1272	CLIP-seq
MIRT1121422	hsa-miR-15a	CLIP-seq
MIRT1121423	hsa-miR-15b	CLIP-seq
MIRT1121424	hsa-miR-16	CLIP-seq
MIRT1121425	hsa-miR-1827	CLIP-seq
MIRT1121426	hsa-miR-195	CLIP-seq
MIRT1121427	hsa-miR-2110	CLIP-seq
MIRT1121428	hsa-miR-2467-3p	CLIP-seq
MIRT1121429	hsa-miR-3120-3p	CLIP-seq
MIRT1121430	hsa-miR-3124-3p	CLIP-seq
MIRT1121431	hsa-miR-3148	CLIP-seq
MIRT1121432	hsa-miR-3151	CLIP-seq
MIRT1121433	hsa-miR-320a	CLIP-seq
MIRT1121434	hsa-miR-320b	CLIP-seq
MIRT1121435	hsa-miR-320c	CLIP-seq
MIRT1121436	hsa-miR-320d	CLIP-seq
MIRT1121437	hsa-miR-3545-5p	CLIP-seq
MIRT1121438	hsa-miR-3622a-5p	CLIP-seq
MIRT1121439	hsa-miR-3672	CLIP-seq
MIRT1121440	hsa-miR-3678-3p	CLIP-seq
MIRT1121441	hsa-miR-3679-3p	CLIP-seq
MIRT1121442	hsa-miR-3975	CLIP-seq
MIRT1121443	hsa-miR-424	CLIP-seq
MIRT1121444	hsa-miR-4263	CLIP-seq
MIRT1121445	hsa-miR-4265	CLIP-seq
MIRT1121446	hsa-miR-4271	CLIP-seq
MIRT1121447	hsa-miR-4296	CLIP-seq
MIRT1121448	hsa-miR-4317	CLIP-seq
MIRT1121449	hsa-miR-4322	CLIP-seq
MIRT1121450	hsa-miR-4325	CLIP-seq
MIRT1121451	hsa-miR-4326	CLIP-seq
MIRT1121452	hsa-miR-4330	CLIP-seq
MIRT1121453	hsa-miR-4420	CLIP-seq
MIRT1121454	hsa-miR-4429	CLIP-seq
MIRT1121455	hsa-miR-4447	CLIP-seq
MIRT1121456	hsa-miR-4472	CLIP-seq
MIRT1121457	hsa-miR-4524	CLIP-seq
MIRT1121458	hsa-miR-4649-3p	CLIP-seq
MIRT1121459	hsa-miR-4668-5p	CLIP-seq
MIRT1121460	hsa-miR-4676-5p	CLIP-seq
MIRT1121461	hsa-miR-4694-5p	CLIP-seq
MIRT1121462	hsa-miR-4725-3p	CLIP-seq
MIRT1121463	hsa-miR-4760-3p	CLIP-seq
MIRT1121464	hsa-miR-4799-5p	CLIP-seq
MIRT1121465	hsa-miR-4803	CLIP-seq
MIRT1121466	hsa-miR-491-5p	CLIP-seq
MIRT1121467	hsa-miR-497	CLIP-seq
MIRT1121468	hsa-miR-503	CLIP-seq
MIRT1121469	hsa-miR-548aa	CLIP-seq
MIRT1121470	hsa-miR-564	CLIP-seq
MIRT1121471	hsa-miR-575	CLIP-seq
MIRT1121472	hsa-miR-576-5p	CLIP-seq
MIRT1121473	hsa-miR-577	CLIP-seq
MIRT1121474	hsa-miR-646	CLIP-seq
MIRT1121475	hsa-miR-759	CLIP-seq
MIRT2034346	hsa-let-7a	CLIP-seq
MIRT2034347	hsa-let-7b	CLIP-seq
MIRT2034348	hsa-let-7c	CLIP-seq
MIRT2034349	hsa-let-7d	CLIP-seq
MIRT2034350	hsa-let-7e	CLIP-seq
MIRT2034351	hsa-let-7f	CLIP-seq
MIRT2034352	hsa-let-7g	CLIP-seq
MIRT2034353	hsa-let-7i	CLIP-seq
MIRT2034354	hsa-miR-1294	CLIP-seq
MIRT1121422	hsa-miR-15a	CLIP-seq
MIRT1121423	hsa-miR-15b	CLIP-seq
MIRT1121424	hsa-miR-16	CLIP-seq
MIRT1121426	hsa-miR-195	CLIP-seq
MIRT2034355	hsa-miR-202	CLIP-seq
MIRT1121427	hsa-miR-2110	CLIP-seq
MIRT1121429	hsa-miR-3120-3p	CLIP-seq
MIRT1121431	hsa-miR-3148	CLIP-seq
MIRT1121432	hsa-miR-3151	CLIP-seq
MIRT2034356	hsa-miR-3936	CLIP-seq
MIRT1121443	hsa-miR-424	CLIP-seq
MIRT1121446	hsa-miR-4271	CLIP-seq
MIRT2034357	hsa-miR-4316	CLIP-seq
MIRT1121450	hsa-miR-4325	CLIP-seq
MIRT1121453	hsa-miR-4420	CLIP-seq
MIRT1121455	hsa-miR-4447	CLIP-seq
MIRT2034358	hsa-miR-4458	CLIP-seq
MIRT1121456	hsa-miR-4472	CLIP-seq
MIRT2034359	hsa-miR-4490	CLIP-seq
MIRT2034360	hsa-miR-4500	CLIP-seq
MIRT1121457	hsa-miR-4524	CLIP-seq
MIRT1121459	hsa-miR-4668-5p	CLIP-seq
MIRT1121462	hsa-miR-4725-3p	CLIP-seq
MIRT1121463	hsa-miR-4760-3p	CLIP-seq
MIRT2034361	hsa-miR-4766-5p	CLIP-seq
MIRT2034362	hsa-miR-4774-5p	CLIP-seq
MIRT1121466	hsa-miR-491-5p	CLIP-seq
MIRT1121467	hsa-miR-497	CLIP-seq
MIRT1121468	hsa-miR-503	CLIP-seq
MIRT1121474	hsa-miR-646	CLIP-seq
MIRT1121475	hsa-miR-759	CLIP-seq
MIRT2034363	hsa-miR-98	CLIP-seq
MIRT1121419	hsa-miR-1229	CLIP-seq
MIRT1121420	hsa-miR-1264	CLIP-seq
MIRT2264856	hsa-miR-140-3p	CLIP-seq
MIRT1121422	hsa-miR-15a	CLIP-seq
MIRT1121423	hsa-miR-15b	CLIP-seq
MIRT1121424	hsa-miR-16	CLIP-seq
MIRT1121425	hsa-miR-1827	CLIP-seq
MIRT1121426	hsa-miR-195	CLIP-seq
MIRT1121429	hsa-miR-3120-3p	CLIP-seq
MIRT1121431	hsa-miR-3148	CLIP-seq
MIRT2264857	hsa-miR-3184	CLIP-seq
MIRT2264858	hsa-miR-3185	CLIP-seq
MIRT1121433	hsa-miR-320a	CLIP-seq
MIRT1121434	hsa-miR-320b	CLIP-seq
MIRT1121435	hsa-miR-320c	CLIP-seq
MIRT1121436	hsa-miR-320d	CLIP-seq
MIRT1121438	hsa-miR-3622a-5p	CLIP-seq
MIRT2264859	hsa-miR-3653	CLIP-seq
MIRT2264860	hsa-miR-377	CLIP-seq
MIRT2264861	hsa-miR-423-5p	CLIP-seq
MIRT1121443	hsa-miR-424	CLIP-seq
MIRT1121450	hsa-miR-4325	CLIP-seq
MIRT1121452	hsa-miR-4330	CLIP-seq
MIRT1121454	hsa-miR-4429	CLIP-seq
MIRT1121457	hsa-miR-4524	CLIP-seq
MIRT1121458	hsa-miR-4649-3p	CLIP-seq
MIRT2264862	hsa-miR-4688	CLIP-seq
MIRT1121463	hsa-miR-4760-3p	CLIP-seq
MIRT2264863	hsa-miR-4788	CLIP-seq
MIRT1121465	hsa-miR-4803	CLIP-seq
MIRT1121467	hsa-miR-497	CLIP-seq
MIRT1121468	hsa-miR-503	CLIP-seq
MIRT1121470	hsa-miR-564	CLIP-seq
MIRT2264864	hsa-miR-587	CLIP-seq
MIRT1121474	hsa-miR-646	CLIP-seq
MIRT2453492	hsa-miR-3662	CLIP-seq
MIRT2453493	hsa-miR-4436b-5p	CLIP-seq
MIRT2453494	hsa-miR-4495	CLIP-seq
MIRT2563776	hsa-miR-1245b-3p	CLIP-seq
MIRT2563776	hsa-miR-1245b-3p	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12975319, 16714279, 32296183
GO:0005634	Component	Nucleus	IDA	12975319
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005683	Component	U7 snRNP	IBA
GO:0005683	Component	U7 snRNP	IDA	11574479
GO:0005683	Component	U7 snRNP	IEA
GO:0005683	Component	U7 snRNP	ISS
GO:0005697	Component	Telomerase holoenzyme complex	IDA	18082603
GO:0006397	Process	MRNA processing	IEA
GO:0006398	Process	MRNA 3'-end processing by stem-loop binding and cleavage	IBA
GO:0006398	Process	MRNA 3'-end processing by stem-loop binding and cleavage	IEA
GO:0006398	Process	MRNA 3'-end processing by stem-loop binding and cleavage	IMP	33230297
GO:0016604	Component	Nuclear body	IDA
GO:0071204	Component	Histone pre-mRNA 3'end processing complex	IEA
GO:0071204	Component	Histone pre-mRNA 3'end processing complex	ISS
GO:0071209	Function	U7 snRNA binding	IBA
GO:0071209	Function	U7 snRNA binding	IDA	12975319
GO:0071209	Function	U7 snRNA binding	IEA
GO:0071209	Function	U7 snRNA binding	IPI	18082603
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	16914750
GO:1902275	Process	Regulation of chromatin organization	IMP	33230297
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
617910	30860	ENSG00000155858

P83369

Protein name

U7 snRNA-associated Sm-like protein LSm11

Protein function

Component of the U7 snRNP complex that is involved in the histone 3'-end pre-mRNA processing (PubMed:11574479, PubMed:16914750, PubMed:33230297). Increases U7 snRNA levels but not histone 3'-end pre-mRNA processing activity, when overexpressed (

PDB

6V4X , 8G1U

Family and domains

Sequence

MEERERGARSAGAGSPARPPSPRLDVSSDSFDPLLALYAPRLPPIPYPNAPCFNNVAEYE
SFLRTGVRGGGRGRGRARGAAAGSGVPAAPGPSGRTRRRPDAPAPDPERIQRLRRLMVAK
EEGDGAAGAGRRGPGRSRKAPRNVLTRMPLHEGSPLGELHRCIREGVKVNVHIRTFKGLR
GVCTGFLVAFDKFWNMALTDVDETYRKPVLGKAYERDSSLTLTRLFDRLKLQDSSKKEAD
SKSAVEDSTLSRYSQTSTWKLASVWGRADTGRGSHKRSRSVPSSLQASAREESRSELSGR
TTRTDGSSVGGTFSRATTLSRGQSRKKKRKPKVDYQQVFTRHINQIFIRGENVLLVHLAQ

Sequence length

360

Interactions

View interactions

	Reactome
			SLBP independent Processing of Histone Pre-mRNAs RNA Polymerase II Transcription Termination SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Aicardi-Goutieres syndrome 8	Pathogenic	rs2113077087	RCV001568350	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GILLES DE LA TOURETTE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LSM11-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Aicardi Goutieres syndrome	Aicardi goutieres syndrome	Pubtator	33230297, 35320431, 38041217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34482648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	33230297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36939200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LSM11 (LSM11, U7 small nuclear RNA associated)