ADORA1 (adenosine A1 receptor)

Gene

• Entrez ID: 134
• Gene name: Adenosine A1 receptor
• Gene symbol: ADORA1
• Synonyms (NCBI Gene): RDC7
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: The protein encoded by this gene is an adenosine receptor that belongs to the G-protein coupled receptor 1 family. There are 3 types of adenosine receptors, each with a specific pattern of ligand binding and tissue distribution, and together they regulate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT769574	hsa-miR-1205	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT769577	hsa-miR-1909	CLIP-seq
MIRT769578	hsa-miR-1915	CLIP-seq
MIRT769579	hsa-miR-1976	CLIP-seq
MIRT769580	hsa-miR-3202	CLIP-seq
MIRT769581	hsa-miR-3918	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT769583	hsa-miR-4650-5p	CLIP-seq
MIRT769584	hsa-miR-4661-3p	CLIP-seq
MIRT769585	hsa-miR-4726-3p	CLIP-seq
MIRT769586	hsa-miR-4747-5p	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT1927025	hsa-miR-1266	CLIP-seq
MIRT769578	hsa-miR-1915	CLIP-seq
MIRT1927026	hsa-miR-24	CLIP-seq
MIRT1927027	hsa-miR-4514	CLIP-seq
MIRT1927028	hsa-miR-4518	CLIP-seq
MIRT1927029	hsa-miR-4645-5p	CLIP-seq
MIRT1927030	hsa-miR-4673	CLIP-seq
MIRT1927031	hsa-miR-4692	CLIP-seq
MIRT1927032	hsa-miR-4717-3p	CLIP-seq
MIRT769585	hsa-miR-4726-3p	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT1927033	hsa-miR-940	CLIP-seq
MIRT2167878	hsa-miR-1184	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT2167879	hsa-miR-1273f	CLIP-seq
MIRT2167880	hsa-miR-136	CLIP-seq
MIRT2167881	hsa-miR-141	CLIP-seq
MIRT2167882	hsa-miR-15a	CLIP-seq
MIRT2167883	hsa-miR-15b	CLIP-seq
MIRT2167884	hsa-miR-16	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT2167885	hsa-miR-195	CLIP-seq
MIRT2167886	hsa-miR-1972	CLIP-seq
MIRT2167887	hsa-miR-200a	CLIP-seq
MIRT2167888	hsa-miR-2117	CLIP-seq
MIRT2167889	hsa-miR-22	CLIP-seq
MIRT1927026	hsa-miR-24	CLIP-seq
MIRT2167890	hsa-miR-3176	CLIP-seq
MIRT2167891	hsa-miR-3183	CLIP-seq
MIRT2167892	hsa-miR-3665	CLIP-seq
MIRT2167893	hsa-miR-3922-3p	CLIP-seq
MIRT2167894	hsa-miR-424	CLIP-seq
MIRT2167895	hsa-miR-4255	CLIP-seq
MIRT2167896	hsa-miR-4269	CLIP-seq
MIRT2167897	hsa-miR-4273	CLIP-seq
MIRT2167898	hsa-miR-4279	CLIP-seq
MIRT2167899	hsa-miR-4283	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT2167900	hsa-miR-4435	CLIP-seq
MIRT2167901	hsa-miR-4437	CLIP-seq
MIRT2167902	hsa-miR-4447	CLIP-seq
MIRT2167903	hsa-miR-4472	CLIP-seq
MIRT2167904	hsa-miR-4488	CLIP-seq
MIRT1927027	hsa-miR-4514	CLIP-seq
MIRT769583	hsa-miR-4650-5p	CLIP-seq
MIRT1927031	hsa-miR-4692	CLIP-seq
MIRT2167905	hsa-miR-4697-5p	CLIP-seq
MIRT2167906	hsa-miR-4723-3p	CLIP-seq
MIRT2167907	hsa-miR-4736	CLIP-seq
MIRT2167908	hsa-miR-4742-5p	CLIP-seq
MIRT2167909	hsa-miR-4756-3p	CLIP-seq
MIRT2167910	hsa-miR-497	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq
MIRT2167911	hsa-miR-615-5p	CLIP-seq
MIRT2167912	hsa-miR-922	CLIP-seq
MIRT1927033	hsa-miR-940	CLIP-seq
MIRT769575	hsa-miR-1249	CLIP-seq
MIRT2167881	hsa-miR-141	CLIP-seq
MIRT769576	hsa-miR-188-3p	CLIP-seq
MIRT2167887	hsa-miR-200a	CLIP-seq
MIRT769582	hsa-miR-4290	CLIP-seq
MIRT769587	hsa-miR-532-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	9547356
RELA	Activation	9547356

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001609	Function	G protein-coupled adenosine receptor activity	IBA
GO:0001609	Function	G protein-coupled adenosine receptor activity	IEA
GO:0001609	Function	G protein-coupled adenosine receptor activity	ISS	11390975
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	ISS	11390975
GO:0001666	Process	Response to hypoxia	IEA
GO:0001883	Function	Purine nucleoside binding	IEA
GO:0001973	Process	G protein-coupled adenosine receptor signaling pathway	IEA
GO:0002087	Process	Regulation of respiratory gaseous exchange by nervous system process	IEA
GO:0002674	Process	Negative regulation of acute inflammatory response	IEA
GO:0002686	Process	Negative regulation of leukocyte migration	IEA
GO:0002793	Process	Positive regulation of peptide secretion	IEA
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0003093	Process	Regulation of glomerular filtration	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	16481441, 23291003, 28298427
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	25644539
GO:0005886	Component	Plasma membrane	IDA	27134041
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1530647
GO:0005929	Component	Cilium	IDA
GO:0006612	Process	Protein targeting to membrane	IEA
GO:0006909	Process	Phagocytosis	TAS	8360491
GO:0006954	Process	Inflammatory response	TAS	8360491
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	1530647
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	7818494
GO:0007399	Process	Nervous system development	TAS	8450977
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0014050	Process	Negative regulation of glutamate secretion	IEA
GO:0014074	Process	Response to purine-containing compound	IDA	25644539
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030425	Component	Dendrite	IEA
GO:0030673	Component	Axolemma	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0032244	Process	Positive regulation of nucleoside transport	IEA
GO:0032279	Component	Asymmetric synapse	IEA
GO:0032795	Function	Heterotrimeric G-protein binding	IEA
GO:0032900	Process	Negative regulation of neurotrophin production	IEA
GO:0035306	Process	Positive regulation of dephosphorylation	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	ISS	11390975
GO:0042311	Process	Vasodilation	IEA
GO:0042321	Process	Negative regulation of circadian sleep/wake cycle, sleep	IEA
GO:0042323	Process	Negative regulation of circadian sleep/wake cycle, non-REM sleep	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043268	Process	Positive regulation of potassium ion transport	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0044297	Component	Cell body	IEA
GO:0044305	Component	Calyx of Held	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0048786	Component	Presynaptic active zone	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050890	Process	Cognition	IEA
GO:0050900	Process	Leukocyte migration	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0050995	Process	Negative regulation of lipid catabolic process	IEA
GO:0050996	Process	Positive regulation of lipid catabolic process	IEA
GO:0051930	Process	Regulation of sensory perception of pain	IEA
GO:0051967	Process	Negative regulation of synaptic transmission, glutamatergic	IEA
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0055117	Process	Regulation of cardiac muscle contraction	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0070254	Process	Mucus secretion	IEA
GO:0070256	Process	Negative regulation of mucus secretion	IEA
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0086004	Process	Regulation of cardiac muscle cell contraction	IEA
GO:0097190	Process	Apoptotic signaling pathway	TAS	7818494
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IEA
GO:1900453	Process	Negative regulation of long-term synaptic depression	IEA

Other IDs

• MIM: 102775
• HGNC: 262
• e!Ensembl: ENSG00000163485

Protein

• UniProt ID: P30542
• Protein name: Adenosine receptor A1
• Protein function: Receptor for adenosine. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase.
• PDB: 5N2S, 5UEN, 6D9H, 7LD3, 7LD4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	26 → 288	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
  LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
  PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
  VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
  FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
  KIWNDHFRCQPAPPIDEDLPEERPDD

• Sequence length: 326

Pathways

KEGG:

cGMP-PKG signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes
Renin secretion
Morphine addiction

Reactome:

Adenosine P1 receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ADORA1-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRADYCARDIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	18241242	Stimulate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20520601		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	24943643, 33235193	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20520601		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	26317759	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	29097738		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29695862		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	39684939	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11728229, 14754517, 16364194		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	27182965, 30929738, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	36818476	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	27462069	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	26317759	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	20609566	Associate	★☆☆☆☆ Found in Text Mining only
Brain Stem Ischemia, Transient	Cerebral Ischemia	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19935720		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19935720, 28971320, 32777015, 33096318	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	17088462		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21603615	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	CTD_human_DG	9407998		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30225882		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27814614		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27814614	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30225882		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28950257		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21603615		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27091178	Associate	★☆☆☆☆ Found in Text Mining only
Crescendo Transient Ischemic Attacks	Transient Ischemic Attack	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	24264405		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26317759	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20518753, 24264405, 24682832		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20518753, 24264405, 24682832		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24264405, 24682832		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	10459555, 9493493		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	31353670	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27038930, 28415676		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15257174		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	26317759		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27038930		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	27134041		★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	34944069	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37001853	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	9514582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19935720		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24896321		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	34944069	Associate	★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15806158		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12160945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21603615		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	21603615	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30875759		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31638096		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	29672450		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34944069	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	9493493		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37337170	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27134041		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32817461	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	27134041		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	LHGDN	18052973		★☆☆☆☆ Found in Text Mining only
Posterior Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	28789481		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28950257		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	19820430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19820430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	39684939	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29380238		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30365112		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	31600096		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24896321, 30875759		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24896321	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	CTD_human_DG	18950269		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17914110, 32766727	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26317759	Associate	★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	23437309		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack, Anterior Circulation	Transient Ischemic Attack	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack, Vertebrobasilar Circulation	Transient Ischemic Attack	CTD_human_DG	23437309		★☆☆☆☆ Found in Text Mining only